Details for Kale Locus Bo5g140140

Position : C5 ( 5`- 43681755 .. 43683586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140140

Protein [Map View]
MVGLRLKALFFVLLVVMAISIANAAKDLKEQDVGVQRNLHEDDKGDKKDAKGEKGDKKDDKKEDKEESVGSKVAKKVKGA
AASVASAASNASAASAASAASAASAASGKIKGAVAPIGDKLGLKGPSGPSIDVKASGAKGDGKTDDTAAFMAVWKKAIEA
TTPTTITVPKGDYLVEELLLEGPSKSPITFEMHGNLKAPSAVTTRKPHSGWVNFRKLKDFNLIGNGAIFDGQGSVAWKVN
DCKQTGKCNNLPINIRLTQLDNSRISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPAESLNTDGIHVGKSVGVTIRGSKI
KTGDDCISIGGGTENLLVEGVECGPGHGLSIGSLGKYPNEEPVKGITIRKCIVKHTDNGVRIKTWPGSPPGLVSGALFED
ITMDNVSLPILVDQVYCPHGKCKSGPSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVS
ACSNVKPTVTGKMIPAACTEECKPDKK*

DNA
ATGGTGGGCTTGCGACTTAAGGCGTTGTTTTTTGTACTACTAGTGGTTATGGCCATCTCAATAGCAAACGCTGCCAAGGA
TCTCAAAGAACAAGATGTTGGAGTCCAAAGAAACTTACATGAAGACGACAAAGGTGATAAAAAAGATGCTAAAGGTGAGA
AAGGTGATAAAAAAGATGATAAGAAAGAAGATAAAGAAGAATCAGTTGGTTCTAAAGTAGCCAAAAAAGTCAAAGGAGCT
GCTGCATCTGTTGCATCAGCTGCATCCAATGCATCTGCTGCCTCAGCTGCATCTGCCGCTTCTGCTGCCTCTGCTGCATC
AGGTAAAATCAAAGGAGCTGTTGCACCTATTGGTGATAAGTTGGGACTCAAAGGCCCAAGCGGTCCATCAATTGATGTTA
AAGCATCTGGAGCTAAAGGAGACGGCAAAACCGATGACACTGCGGCATTTATGGCAGTATGGAAAAAAGCTATTGAAGCA
ACAACACCAACAACGATTACAGTGCCAAAGGGTGACTACTTGGTGGAAGAATTACTACTCGAAGGTCCAAGCAAAAGTCC
TATCACTTTCGAAATGCATGGCAATCTTAAGGCTCCATCTGCTGTCACCACCCGAAAACCACATAGTGGATGGGTTAATT
TCAGAAAACTCAAGGATTTCAATTTGATTGGAAACGGAGCCATTTTTGACGGTCAAGGCTCAGTGGCTTGGAAGGTCAAT
GACTGCAAACAGACCGGCAAATGCAACAATCTCCCCATCAACATCCGACTTACGCAACTCGATAACTCAAGAATTAGCGG
CATAACATCAACAAACAGCAAGCTATTCCACATGAACATCCATCAATGCACCAACGTAACTCTTCAAGATGTTCATATTG
ACGCACCTGCTGAGAGTCTCAACACCGATGGTATCCACGTCGGAAAGTCCGTAGGTGTCACCATAAGAGGGTCAAAGATC
AAAACCGGAGATGACTGCATTTCCATTGGAGGCGGTACTGAAAATTTACTTGTGGAGGGCGTAGAATGTGGACCAGGACA
CGGTCTTTCCATCGGAAGTCTTGGAAAGTACCCAAATGAGGAACCAGTGAAAGGAATCACCATTCGTAAATGCATCGTCA
AGCATACCGATAATGGTGTTCGTATCAAAACATGGCCTGGATCTCCCCCTGGTCTCGTCTCCGGCGCTCTTTTTGAAGAT
ATCACCATGGATAATGTTAGCTTGCCCATTCTCGTCGACCAAGTGTACTGCCCTCATGGCAAATGCAAATCAGGGCCATC
AAAGGTGCAGTTGGAGAACCTGAGCTTCAAGAACATTAGGGGCACATCATCAACAAAGATTGCTGTGCAATTAAACTGCA
GCCCAGGCTGTCCTTGCAAGAATGTTGCTTTGGCTGACATAAACTTGGTCAGCACTGGTAAAGAGGGAGCAGCTGTCTCG
GCATGTTCTAACGTCAAGCCTACTGTCACCGGGAAAATGATTCCAGCGGCTTGCACCGAAGAATGTAAACCGGATAAAAA
GTAA