Details for Kale Locus Bo5g140120

Position : C5 ( 5`- 43670748 .. 43672012 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140120

Protein [Map View]
MSGAVSGSRDMGFVDNNNNKKDGDDGNTSKTASSHQHEGTDDEGAGSLGRQMSEASLSAAEEEEEDDSKLQLGPQYTIKE
HLEKDKDDESLRKWKEQLLGSVDVTNIGETLDPEVKIISLAILSPGRPDIVLMVPENGNPKGMWFTLKEGSKYCLKFTFQ
VKNNIVSGLRYTNTVWKTGVKVDRGKEMLGTFSPQSEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFD
IRKEWPAV*

DNA
ATGTCTGGAGCTGTATCTGGTTCCAGGGACATGGGTTTCGTCGACAACAATAACAACAAGAAAGACGGCGACGACGGAAA
CACTTCCAAAACGGCGTCGTCTCACCAACACGAGGGCACCGACGACGAGGGTGCTGGATCCTTGGGGAGGCAAATGAGCG
AAGCCTCTCTTAGCGCTGCTGAGGAGGAAGAAGAAGATGATTCCAAATTACAATTGGGTCCTCAGTACACTATCAAGGAA
CATCTCGAGAAGGATAAGGATGATGAGAGTCTGAGGAAGTGGAAAGAACAGCTTCTTGGAAGTGTTGATGTTACCAACAT
TGGAGAGACTCTTGACCCTGAAGTGAAGATCATTAGCCTGGCGATCTTATCCCCTGGAAGACCAGATATTGTTCTAATGG
TTCCGGAGAATGGGAACCCAAAGGGGATGTGGTTTACTTTGAAAGAAGGGAGCAAGTACTGTTTGAAGTTCACGTTTCAG
GTTAAAAACAACATTGTCTCTGGTCTTAGGTACACCAATACCGTTTGGAAGACCGGTGTTAAAGTGGACAGAGGAAAGGA
AATGCTTGGAACCTTTAGTCCTCAGTCGGAGCCATACAACCACGTGATGCCTGAAGAGACCACTCCTTCTGGCATGTTTG
CTCGAGGATCTTATTCTGCTAGAACTAAGTTTCTTGACGATGATAACAAGTGCTACTTGGAGATCAACTACAGCTTCGAC
ATCCGTAAAGAATGGCCTGCTGTTTAA