Details for Kale Locus Bo5g140110

Position : C5 ( 5`- 43667377 .. 43669405 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140110

Protein [Map View]
MFGIQNRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGFTVEGNVDDVNVLNEVREKVRNQGRVWWALEASKGANWY
LQPEILLIGDGIALKKTSLKISTLTNAITLKRLVRKGIPPVLRPKVWFSLSGAAKKKSTVPESYYSDLSKAVDGKVTPAT
LQIDHDLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAFWMLAVLLENVLVRDCY
TTNLSGCHVEQRVFKDLLAQKCPRIASHLDDMGFDVSLVATEWFLCLFSKSLPSETTLRVWDVLFYEGAKVLFHAALAIF
KMKENELLMTHQVGDVINIIQTTSHQLFDPDELLTVAFEKIGSMTTNTISKQRKKQEPAVLAELDQRLRRLNSLKETGKN
A*

DNA
ATGTTTGGGATCCAAAACAGGCGAGACCTAACGATGGAGCTCCAATCGCAGATCCCCATCCTCCGCCCGAGCATCCACGC
CCGACGAGCCAACATCGTCGTGAAGTTCCAGGACCTGTACGGGTTCACGGTGGAAGGCAATGTCGACGACGTGAACGTCC
TGAACGAAGTTCGAGAGAAGGTGAGGAACCAGGGGCGGGTGTGGTGGGCTCTGGAAGCGAGCAAAGGAGCTAACTGGTAT
CTCCAGCCCGAGATTCTCTTGATCGGCGACGGTATCGCCTTGAAGAAGACGTCTCTCAAGATCTCGACTCTGACGAATGC
CATTACGTTGAAGAGGTTGGTTAGGAAAGGGATCCCTCCTGTGTTGAGGCCTAAGGTTTGGTTCTCTCTCTCTGGTGCTG
CGAAGAAGAAGTCTACTGTCCCGGAGAGTTATTATAGTGATTTGAGTAAGGCTGTTGATGGGAAGGTTACGCCTGCTACG
CTGCAGATTGATCATGATTTGCCACGGACTTTCCCAGGGCATCCGTGGTTGGACACTCCAGAAGGTCATGCTGCTCTACG
ACGTGTGCTTGTTGGCTATTCTTTTCGCGACTCTGATGTTGGCTATTGTCAGGGGCTAAACTACGTTGCAGCGTTACTAT
TGCTTGTGATGAAGACAGAAGAAGACGCGTTCTGGATGCTAGCAGTGCTTTTGGAAAACGTATTGGTCCGTGACTGCTAC
ACAACCAACTTGTCTGGATGCCATGTTGAGCAGCGGGTTTTCAAAGATCTGCTCGCCCAAAAGTGTCCTCGAATAGCTAG
TCATCTTGACGATATGGGCTTTGATGTCTCCCTTGTAGCCACAGAGTGGTTTCTATGCCTCTTCTCCAAAAGCTTGCCTT
CTGAGACAACTCTAAGAGTGTGGGATGTACTTTTCTATGAAGGAGCAAAGGTTCTTTTTCATGCAGCTTTGGCAATATTC
AAGATGAAAGAAAACGAGCTGCTTATGACTCACCAGGTCGGTGATGTGATCAACATAATACAGACCACCTCTCACCAGCT
CTTTGACCCTGATGAATTATTGACGGTGGCGTTTGAGAAAATTGGATCCATGACAACCAACACAATATCAAAGCAGAGGA
AGAAGCAGGAACCGGCGGTGCTGGCAGAACTTGACCAGAGACTTCGCAGACTCAACTCTCTTAAAGAAACTGGTAAGAAC
GCTTGA