Details for Kale Locus Bo5g140100

Position : C5 ( 5`- 43659249 .. 43661547 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140100

Protein [Map View]
MGTWKKKNSYQNKVSYISVPAQIIKSVSSSSLTHNKSSKKNTTKFLFLLLRNPKLWAFCLLSLSVLGIVSRLGPCLSPSG
PHQESQLQSSDSIAYTRSNSTHAEIPNADDRSLDMIPKPPVAVVEKNETFGGDSKLIITSKHVLGDKNEFWKQPDGLGYK
PCLDFSSAYRRESKRIVRERRKYLMVVVSGGMNQQKNQIVDAVVIARILGAVLVVPVLQVNLIWGDESEFSDIFDLERFK
SVLADDVKIVSLLPANKIMTRPTEDGGMPFNASPQWIRSHYLKRFNRDGVLLLRRLDSRLSKDLPSDLQKLRCKAAFEAL
KFSPRVMELGKKLAERMRSKGPYIALHLRLEKDVWVRTGCLTGLSSKYDEIARLEGIKRPELLTAKSSMTPNERKLAGLC
PLNAKEVTRLLRALGAPRDARIYWAGGEPLGRKEALRPLTSEFPHLYNKYDIAFPLELKPFAKRASIMAAIDYIVCKESD
VFMASHGGNMGRAIQGHRAYEGHKKLITPNKRQMLPYFLNTSMTETEFEKMMKKLHRQSLGQPEIRVSKAGRDVTKYPVP
ECMCNNQTTPTV*

DNA
ATGGGAACATGGAAGAAGAAAAATAGTTATCAGAACAAAGTTAGCTACATATCAGTCCCAGCTCAGATCATAAAGTCAGT
TTCTTCCTCGTCTCTTACACACAATAAATCTTCAAAGAAGAACACGACCAAGTTCTTGTTTCTTCTCCTCAGAAACCCAA
AGCTCTGGGCGTTCTGTCTCCTCTCGCTTTCTGTTTTAGGAATTGTATCACGACTTGGTCCTTGTCTTTCTCCTTCCGGT
CCACATCAAGAAAGTCAACTTCAGAGCTCCGATTCAATTGCGTATACCCGATCAAACAGTACTCATGCTGAGATTCCGAA
TGCAGATGATCGATCTTTAGATATGATTCCAAAACCACCAGTGGCTGTTGTGGAGAAGAATGAGACCTTTGGTGGTGATT
CAAAGCTGATCATCACCTCTAAACATGTTTTGGGTGATAAGAATGAGTTTTGGAAGCAGCCTGATGGATTAGGATACAAG
CCGTGCCTGGACTTCAGCTCTGCGTACAGGAGAGAGAGCAAGAGGATTGTTAGAGAGAGGAGAAAGTATCTGATGGTGGT
TGTCTCCGGTGGGATGAACCAGCAGAAGAATCAGATTGTGGACGCAGTTGTGATTGCCAGGATCCTAGGTGCTGTTCTTG
TCGTCCCAGTATTGCAAGTCAATCTAATTTGGGGTGACGAGAGTGAATTTTCAGATATATTTGATTTAGAGAGATTCAAG
AGTGTTTTAGCAGATGATGTGAAGATAGTCTCTTTGCTGCCGGCAAATAAAATAATGACTAGACCAACAGAAGATGGTGG
TATGCCTTTCAATGCTTCTCCTCAATGGATCCGTTCACACTATCTAAAACGATTTAACAGGGATGGAGTTCTGCTTTTAA
GGAGATTGGATTCAAGATTGTCTAAAGACTTACCCTCTGATCTCCAGAAGCTTCGTTGTAAGGCAGCGTTTGAAGCACTG
AAGTTCTCGCCAAGGGTGATGGAGTTGGGGAAGAAGCTAGCAGAGAGGATGAGGAGCAAAGGTCCTTACATTGCGCTTCA
TCTTCGGTTGGAGAAAGACGTGTGGGTGAGAACAGGCTGCCTTACTGGTTTGAGCTCAAAGTATGACGAGATTGCAAGAC
TAGAAGGGATTAAGCGGCCTGAGCTCTTAACAGCCAAATCTAGCATGACGCCTAACGAGAGGAAACTAGCAGGTCTATGT
CCATTAAATGCCAAGGAAGTAACAAGGCTGCTTAGAGCACTTGGAGCACCGAGAGACGCTAGGATCTACTGGGCTGGAGG
GGAACCTCTGGGCAGAAAGGAAGCTCTGAGACCGTTAACAAGTGAATTCCCACATCTTTACAACAAATACGATATAGCAT
TTCCCCTTGAACTCAAACCTTTCGCGAAACGAGCTTCCATAATGGCAGCAATAGACTATATAGTCTGCAAGGAGAGTGAT
GTGTTCATGGCATCTCATGGAGGAAACATGGGCCGCGCGATTCAGGGTCACAGAGCTTACGAAGGACACAAGAAGCTTAT
AACACCAAACAAAAGGCAAATGCTCCCATACTTTTTGAACACATCAATGACTGAGACAGAGTTCGAGAAGATGATGAAAA
AACTACACAGACAATCTCTAGGACAGCCGGAAATAAGGGTTAGCAAAGCTGGAAGAGATGTTACAAAGTATCCTGTTCCT
GAGTGTATGTGCAATAATCAAACCACTCCCACTGTTTAA