Details for Kale Locus Bo5g140080

Position : C5 ( 5`- 43652151 .. 43654189 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140080

Protein [Map View]
MSQFFSEHLSCSRCLGSSLEMSLGQANVNPLEVSSGSHACLYDLLCSETPRGTLQKDFQTSTSDPRDRLEKLLKQPGNKY
CADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVFSIKLDEWTDEQVDMLVGYGGNNAVNQRFEACNMDQLKKPKP
DSNNEERSDFIRKKYELHQFMDPQDGALCTYEQPTIINNSLPSLCSASASHRSAKNRIGQAFRNSWGRRESDHKCPKKSN
SMAGMVEFVGLIRVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIPEQMPPLKVLVYDKDT
FTTDDFMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWVASKENTLVSDGIISQEEGKVKQDISLRLQKVERGVLEIQLE
CLPLTQ*

DNA
ATGTCCCAGTTTTTTTCTGAACATTTATCTTGTTCTCGTTGTCTCGGCTCTAGTTTAGAAATGTCTCTCGGCCAAGCAAA
TGTCAATCCTCTTGAAGTTTCTTCAGGGTCGCATGCTTGTTTATATGACCTTTTATGTTCAGAGACACCAAGAGGGACTC
TTCAAAAGGATTTTCAGACATCAACTTCTGATCCTCGAGATCGGTTGGAGAAGTTGTTGAAGCAACCTGGTAATAAGTAT
TGTGCTGACTGTGGATCTCCCGAACCTAAATGGGTATCTTTAAGTCTTGGTGTATTTATCTGCATAAAGTGTTCTGGTGT
ACACAGAAGCCTTGGAGTTCATATATCAAAGGTTTTTTCAATTAAGCTAGATGAGTGGACAGATGAGCAAGTTGATATGC
TTGTAGGGTACGGTGGAAACAATGCAGTGAACCAGAGATTCGAAGCTTGCAACATGGACCAGTTAAAGAAACCAAAACCA
GATTCTAATAATGAGGAACGCAGTGATTTCATCAGGAAGAAATATGAGCTGCACCAGTTTATGGATCCACAAGATGGTGC
TTTGTGCACTTATGAGCAGCCTACCATAATAAATAATTCACTACCGTCTTTATGTTCTGCTAGTGCTAGCCACCGGTCTG
CAAAAAACCGTATTGGTCAAGCATTTAGGAATAGCTGGGGAAGAAGAGAATCTGATCACAAATGCCCCAAGAAGAGCAAT
TCTATGGCAGGTATGGTTGAGTTTGTCGGATTGATTAGGGTTAATGTGGTTAAAGGAACAAATCTTGCGGTTCGAGATGT
GATGACCAGCGATCCTTATGTTATCCTTTCTCTTGGCCAACAATCGGTGAAAACAAGAGTGATAAAGAACAACTTGAATC
CTGTGTGGAATGAGACCTTGATGCTTTCCATACCAGAGCAGATGCCTCCTCTCAAAGTGCTAGTGTACGACAAGGATACG
TTCACGACAGATGATTTCATGGGGGAGGCAGAGATAGACATACAACCGTTGGTGAGTGCAGCAAAAGCTTACGAGACATC
GAGCATAAAAGAGCCGATGCAGCTGGGGAGTTGGGTGGCGAGCAAAGAGAACACATTGGTGAGTGATGGCATAATCTCAC
AAGAAGAAGGGAAAGTGAAACAAGATATATCACTCAGGCTTCAAAAGGTGGAGAGAGGTGTTCTTGAGATACAACTTGAA
TGTCTTCCTCTCACTCAATGA