Details for Kale Locus Bo5g140070

Position : C5 ( 5`- 43648634 .. 43650576 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140070

Protein [Map View]
MSSPGASMFTNFTKLCKGLALVLVVGHVLVHFVPATVTTIPFGWNLITSGYFELSVYGVVFSTVSLLFMGKFLEPVWGSK
EFLKFIFVVNFLTYLCVFVTAIALYYITRLEIYLYMPFAGFHGVLAGLLVGIKQIIPDQEVLLVKIKAKWLPSIMLVLSV
ASSFFTLNSAAYLPTLIFGTYMGWLYLRYLQRRPETKLRGDPSDDFAFSTFFPEFLRPVIEPIASIFHRMLCGRSNATSE
DHGYTTSGAPLPGSDSAEASRRRERGARALEERLATERLVPPRNKDELQSDALDSV*

DNA
ATGAGTTCTCCGGGAGCGAGCATGTTCACCAATTTCACCAAGCTCTGCAAAGGACTCGCTCTTGTGCTCGTGGTGGGGCA
CGTCTTGGTTCACTTCGTCCCCGCCACCGTCACGACTATTCCTTTTGGCTGGAATCTGATTACAAGCGGCTATTTCGAAC
TCTCTGTATATGGGGTTGTCTTCAGCACCGTTTCTCTCCTCTTTATGGGAAAGTTTTTGGAGCCTGTCTGGGGTTCCAAG
GAGTTCCTTAAGTTCATCTTCGTCGTGAACTTCCTTACCTATCTCTGTGTTTTCGTCACAGCCATTGCTTTGTACTACAT
TACCAGGCTCGAAATCTACCTATATATGCCCTTTGCTGGTTTTCATGGTGTCTTGGCAGGCCTTCTTGTCGGGATTAAGC
AGATAATACCTGACCAGGAGGTATTGCTCGTAAAGATAAAAGCAAAGTGGTTGCCCTCGATTATGCTAGTTTTGTCAGTT
GCCTCAAGCTTCTTCACACTAAATTCAGCAGCATACCTTCCCACTTTGATATTTGGTACATATATGGGCTGGTTATACCT
CAGATACTTGCAGAGGAGGCCAGAGACTAAGCTCAGAGGTGATCCGAGTGATGACTTTGCCTTCTCCACTTTCTTTCCTG
AATTTCTCAGACCGGTGATTGAACCTATAGCCTCAATATTCCATCGGATGCTTTGTGGACGATCAAATGCCACCAGCGAA
GACCATGGTTATACTACCAGCGGTGCTCCATTACCCGGCTCTGACTCTGCTGAAGCTTCCAGGAGGAGAGAAAGAGGAGC
AAGAGCTCTAGAGGAGAGACTTGCAACGGAAAGGTTGGTTCCTCCAAGGAACAAAGATGAGTTGCAGAGTGATGCTTTGG
ATAGCGTTTAA