Details for Kale Locus Bo5g140060

Position : C5 ( 5`- 43643446 .. 43646356 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140060

Protein [Map View]
MYQKTIILLTILSASLHFCSSSYPFDPRYDQSMSPDLYLETNHLHGHSTRNNHMKNRHGYAPASSPRAFNVKSFGAKANG
NDDSQAFTKAWNAACSSTGTVYVVVPKNRAYTLKSVKFSGPCKSSLIVFKIYGKIEAWKDPSAYEERRLWIVFEAVNNLR
VEGGGRIDGNGNKWWPNSCKINPNLPCLGAPTAVTFVECKNLMDCENVKALNLMVTSPGNSPNTDGIHVTGTRNILIQDS
IIRTGDDCISIVSGSENVRATGITCGPGHGISIGSLGANNSEAYVSNVVVNKATLIGTTNGVRIKTWQGGHGVAKNIIFQ
DIIMKNVTNPIIINQDYCDRVESCPQQKSAVQVSNVLYKNIQGTSSRPVAVKFECSKSIPCQGISMQNVKLVDQIQQDVV
STASCSNVKLDTKGHVSPICT*

DNA
ATGTATCAAAAGACCATAATCTTATTAACAATTCTCTCAGCGTCTCTTCATTTCTGTTCCAGCAGCTACCCATTTGATCC
TAGATATGATCAGTCCATGTCTCCCGATTTGTATCTTGAAACCAATCATCTACATGGTCACAGTACACGTAACAACCACA
TGAAAAATCGCCATGGATATGCTCCTGCATCCTCTCCTCGAGCTTTTAACGTCAAATCTTTCGGTGCTAAAGCCAACGGA
AACGACGATTCTCAGGCATTCACGAAAGCTTGGAACGCAGCTTGTTCATCAACCGGGACAGTTTACGTCGTGGTTCCGAA
AAATAGAGCTTACACTCTTAAGTCGGTCAAATTCTCCGGTCCATGCAAATCATCATTGATTGTTTTTAAGATTTACGGAA
AGATTGAGGCATGGAAAGATCCATCAGCCTACGAGGAACGTAGGCTCTGGATTGTTTTTGAAGCTGTAAATAACCTTCGT
GTTGAAGGCGGTGGACGCATCGACGGTAATGGAAATAAATGGTGGCCAAATTCTTGCAAGATCAATCCTAATCTTCCATG
CCTGGGTGCTCCAACGGCGGTTACGTTTGTGGAGTGCAAGAACTTGATGGATTGCGAAAACGTAAAGGCTTTGAATCTTA
TGGTCACCTCCCCGGGTAATAGTCCTAACACTGATGGGATTCACGTTACCGGAACTCGCAATATCCTCATTCAAGATTCT
ATCATCCGTACTGGTGATGATTGTATATCGATAGTGAGTGGGTCGGAGAATGTGAGAGCGACGGGCATTACATGCGGACC
AGGTCATGGAATCAGCATTGGGAGTTTGGGAGCAAATAACTCAGAAGCATATGTTTCAAATGTGGTGGTCAACAAAGCGA
CTCTTATAGGAACCACTAATGGTGTGAGAATCAAGACTTGGCAGGGAGGACATGGAGTGGCAAAAAATATCATATTCCAA
GACATCATAATGAAAAACGTCACGAACCCAATAATCATCAACCAGGACTATTGTGATCGTGTTGAATCATGTCCCCAACA
GAAATCTGCGGTGCAAGTAAGCAATGTGTTGTACAAAAACATACAAGGGACGAGCTCAAGACCCGTAGCTGTTAAATTTG
AGTGCAGCAAAAGCATCCCATGTCAAGGCATTTCAATGCAAAACGTTAAACTGGTCGACCAAATTCAACAAGATGTCGTC
TCCACAGCTTCATGCTCCAATGTGAAGTTGGACACCAAAGGACACGTTTCTCCTATTTGTACTTGA