Details for Kale Locus Bo5g140040

Position : C5 ( 5`- 43639684 .. 43640426 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140040

Protein [Map View]
MRYSIEMLVRRVIAIPQHSIPSSFHVLPRFCSSSSSASPSSKLFIGGLSYSVDEQSLKDAFSSFGEVEEVRIAYDKGTGR
SRGFGFVDFADKDDALSAKHAMDGKGLLGRPLRIGFALERVRGGPVVVQRFGKPNSDREKKVFK*

DNA
ATGAGGTATAGTATTGAGATGCTTGTGAGACGAGTTATAGCGATACCTCAACACTCGATTCCTTCTAGCTTCCATGTTCT
TCCTCGCTTTTGCTCCTCTTCTTCTTCTGCATCGCCTAGTTCCAAGCTGTTCATCGGAGGGTTATCGTACTCGGTGGACG
AACAATCTCTGAAAGACGCATTCTCTTCCTTCGGAGAGGTGGAAGAAGTTAGGATTGCTTACGACAAGGGAACTGGGAGA
TCAAGAGGATTCGGTTTTGTTGATTTTGCTGACAAAGACGATGCTCTTTCTGCAAAACACGCCATGGATGGGAAGGGATT
ATTGGGTCGGCCATTGAGGATAGGTTTCGCCCTTGAAAGGGTGCGTGGTGGTCCTGTGGTTGTTCAACGTTTTGGGAAAC
CCAATAGCGACAGAGAGAAGAAGGTCTTCAAGTGA