Details for Kale Locus Bo5g140000

Position : C5 ( 5`- 43623450 .. 43627475 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140000

Protein [Map View]
MLIVYYNSQEHRSDDTSHINVELVLVLPVAVGGRADTVREIHTTLSRQRLSIVEVVRRERDSSDSIFDATANALTVHRDT
TSTKTVVSKRRSRSMTETGDLNSVPASGIRPIPFLVIFKDLTHVFSMDAIGREILSMAFPAALALASDPVASLIDTAFIG
RLGAVELAAVGVSIAIFQQASRITIFPIVSVTTSFVAEEDTLEKMKEEEAEEEANKAKNVHANTLAIQDSLEKGVASTTS
NNKNQPQQTPVDVKLTSDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGVKPNSAVLSPAQ
KYLTIRSLGAPALLLSLSVQGIFRGFKDTKTPLYATVASDGLNIILDPIFIFVLRLGVSGAAIAHVISQYFMLLILLIRL
AKEVNLMPPKFGDLQFGKFIRNGGLMRARTIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAIL
ACNFAEKDYNKVSAAASRVIQMSFALGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPINSLTFVLDGVNF
GASDFAYTAYSMVGVAAVSIVAVIYMAKSNGFVGIWIALRA*

DNA
ATGTTGATAGTTTATTATAACTCTCAAGAACATAGAAGTGACGATACATCACACATTAACGTAGAGCTGGTTCTTGTTTT
ACCTGTCGCAGTTGGTGGAAGGGCTGATACTGTAAGGGAGATTCACACCACACTTAGCAGGCAGAGACTGAGCATTGTTG
AGGTTGTTAGAAGAGAAAGAGACTCCTCCGATAGCATTTTTGATGCAACGGCAAACGCCCTGACGGTCCACAGGGACACG
ACAAGTACAAAGACAGTAGTCTCCAAGAGGAGAAGTCGATCGATGACGGAAACTGGTGATCTTAATTCCGTTCCAGCCAG
CGGGATCAGGCCGATCCCATTTCTTGTTATCTTCAAAGATTTAACCCATGTATTCAGTATGGATGCAATTGGGCGAGAGA
TACTAAGCATGGCCTTTCCAGCGGCTTTAGCTTTAGCTTCTGATCCAGTAGCCTCTCTGATTGACACTGCTTTTATAGGA
CGTTTAGGAGCGGTTGAGCTAGCAGCGGTTGGAGTATCCATTGCGATATTCCAACAAGCTTCTAGAATCACGATATTCCC
AATTGTGAGCGTCACAACTTCCTTTGTCGCTGAGGAAGACACATTGGAAAAAATGAAGGAAGAAGAAGCAGAAGAAGAAG
CAAACAAAGCCAAGAATGTTCATGCAAATACTTTGGCTATTCAAGATTCCTTGGAAAAAGGCGTTGCGTCAACCACAAGT
AACAACAAAAACCAGCCGCAGCAAACGCCAGTTGACGTGAAACTAACTTCGGATACAAAGTCAAACAACGGAAACAAAGC
AAATAAGAAAGGAAAGAAGACTATCAAATCGGCATCAACGGCCATGATCATAGGGTTGACCCTAGGCCTTGTGCAAGCTA
TTGTCTTGATTTTCAGTTCGAAGGTGCTTATAGGCATCATGGGAGTTAAACCGAATTCGGCAGTTTTATCACCAGCGCAA
AAGTACTTGACCATACGATCATTAGGTGCTCCTGCATTGCTTTTGTCGCTTTCAGTGCAAGGCATCTTCCGTGGCTTTAA
GGACACCAAAACTCCTCTCTATGCTACTGTTGCATCAGATGGTCTCAATATCATTCTCGACCCCATTTTCATATTTGTGC
TTCGTCTTGGCGTCAGCGGCGCCGCCATTGCTCATGTCATTTCTCAGTACTTCATGCTTCTTATATTGTTGATTCGCCTC
GCTAAAGAAGTTAATTTGATGCCACCAAAATTTGGCGACCTACAGTTCGGAAAGTTTATTAGAAATGGGGGATTAATGCG
GGCAAGAACCATAGCTGTGACATTTTGTCAGACCTTAGCAGCATCAATGGCGGCTCGGCTTGGAACGACACCAATGGCTG
CATTTCAGATCTGTTTACAAGTCTGGTTAACGTCTTCTATGCTCGCCGATGGTCTTGCCGTTGCTGGTCAGGCGATTCTG
GCTTGTAATTTTGCCGAAAAGGACTACAACAAAGTGTCTGCTGCTGCATCACGTGTTATACAGATGAGTTTTGCGTTAGG
ACTTGGACTGTCCGTTTTTGTCGGACTGGGTCTATACTTCGGTTCCGGGGTATTCTCCAAGGATCCTGCCGTTATACATC
TCATAGCCATTGGAATACCGTTTGTAGCAGCAACACAGCCAATAAACTCACTCACTTTTGTATTGGACGGAGTCAATTTT
GGAGCATCTGATTTTGCTTACACTGCATACTCCATGGTAGGAGTTGCGGCCGTAAGCATTGTAGCAGTTATATACATGGC
AAAGTCCAACGGTTTTGTGGGAATATGGATAGCTCTTAGAGCATGA