Details for Kale Locus Bo5g139760

Position : C5 ( 5`- 43518763 .. 43519178 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139760

Protein [Map View]
MRSLLLALFLVLAFHRGEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIGGVSF
SSNNLNNAQSLPAKCGVNLPYSISPSTNCDSIN*

DNA
ATGAGATCTCTCTTACTAGCCTTGTTCCTAGTTCTTGCTTTTCACCGTGGCGAAGCAGCAGTGTCTTGCAACGCCGTGGT
TGGAGATCTTTACCCTTGCCTCTCCTACGTGGTTCAAGGCGGTAACGTCCCAGCGAACTGCTGCAACGGTATCAGAACTC
TCAACAGTCAGGCCCAAACCCCTGTGGACCGTCAGGGCGTTTGCCGTTGCATCAAAAATGCTATCGGAGGAGTCTCTTTC
TCTTCTAACAACCTCAACAATGCTCAGTCTCTGCCTGCTAAGTGTGGTGTGAATCTCCCTTACAGTATCAGCCCTTCCAC
CAACTGCGACAGTATCAACTGA