Details for Kale Locus Bo5g139750

Position : C5 ( 5`- 43516300 .. 43517354 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139750

Protein [Map View]
MDDLSLERIEIPGPTLASLIQRASSSPGDVDGLLFGQIHRIASTTLSDDSPAEPPPSSSSSSSDQIVATVTSFISSGKTV
SFYDPLGRVDSRRIDSLQLGSPDRLLGWFSARRTTANRPSMRELAVASSLSSRFQLPIENSESPNSMPSSVFILLTTPLT
DQLIHTHEYRAYQFRPLNRRLEPRSLGIVNIGPAFRGHYGSFNPKSGFPPLLCEVSSSAMMNEDRDEGSLSGKKQAVKDQ
KEVDALADGFGVGSLKRLVGPEAASYTGGVEEMYERMLAKVESLASEVEKSSAKVLELDNHNRKLRYRVARIER*

DNA
ATGGACGATCTCTCTCTAGAAAGAATCGAGATTCCAGGCCCAACACTAGCTTCCCTCATTCAACGAGCGTCCTCCTCTCC
CGGCGACGTCGACGGCTTGCTCTTCGGCCAAATCCACCGAATCGCCTCCACCACCTTATCCGACGACTCTCCGGCGGAAC
CACCCCCCTCGAGCTCCTCCTCCTCATCTGATCAAATCGTCGCCACAGTCACAAGCTTCATCTCCTCCGGCAAAACCGTC
TCCTTCTACGATCCCCTCGGCCGAGTTGACTCGCGCCGGATCGACTCTCTCCAACTCGGTTCACCTGACCGCCTCCTCGG
CTGGTTCTCTGCCCGGAGAACCACCGCAAACCGCCCCTCCATGCGCGAGCTCGCCGTCGCGTCTTCCCTCTCGTCTCGAT
TTCAGTTACCGATCGAGAACTCGGAAAGCCCTAACTCGATGCCTTCCTCCGTGTTCATCCTTCTCACCACGCCGTTGACG
GATCAGCTAATCCACACGCACGAGTACCGCGCGTACCAGTTCCGCCCTTTAAACCGACGGTTAGAACCGAGATCTCTCGG
TATAGTCAACATCGGACCGGCTTTTCGCGGACATTACGGTTCGTTTAATCCGAAGTCGGGGTTCCCGCCGCTGCTGTGCG
AGGTTAGCAGCTCGGCGATGATGAACGAGGACAGGGACGAAGGTTCTTTGAGCGGGAAGAAGCAAGCGGTGAAGGATCAG
AAGGAAGTTGATGCGTTAGCTGATGGGTTTGGAGTGGGGAGCTTGAAGCGTTTGGTTGGACCTGAAGCTGCGAGCTATAC
AGGGGGTGTTGAGGAGATGTATGAGAGGATGCTGGCGAAAGTCGAGAGCTTGGCTTCGGAGGTTGAGAAGAGCTCCGCTA
AAGTACTTGAACTGGACAATCATAACCGGAAGTTGAGATACCGAGTTGCCAGAATCGAGCGGTGA