Details for Kale Locus Bo5g139690

Position : C5 ( 5`- 43467261 .. 43468619 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139690

Protein [Map View]
MSQLYSSMKPTPVLKDELDIVIPTIRNLDFLEMNDINRILGPKSSCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDP
SGKEINALEQHIKNLLSPSTPHFFNTLYDPYSDGADFVRGYPFSMREGAITAVSHGLWLNVPDYDAPTQLVKPLERNSRK
VYLSIQLPILYVDAVMTIPKGTLFPMCGMNLAYDRELIGPAMYFRLMGDGQPIGRYDDMWAGWCVKVICDHMGWGVKTGL
PYIWHSKASNPFVNLRKEYNGIFWQEEAIPFFQSVTLPKECDSVQQCYIELAKLVNEKLGKVDPYFIKLADGMVTWIEAW
EELNAPKGTETNAPRVTE*

DNA
ATGTCGCAGCTGTATTCTTCAATGAAACCTACCCCAGTGCTGAAAGATGAGCTAGACATCGTGATACCAACGATTCGAAA
CCTAGATTTCCTCGAGATGAACGACATTAACAGAATCTTGGGTCCCAAGTCTTCTTGCATTTCCTTTAAAGACTCTGCTT
GTCGTTGCTTTGGTTACATGGTCTCCAAGAAGAAGTACATCTACACCATTGATGATGATTGCTTTGTTGCAAAGGATCCA
TCAGGAAAAGAGATCAATGCACTTGAGCAGCATATCAAGAACCTCTTATCTCCATCAACTCCACATTTCTTTAACACACT
CTATGATCCATACAGTGATGGAGCAGACTTTGTTCGTGGATACCCTTTTAGCATGCGTGAAGGAGCCATAACCGCGGTCT
CTCATGGCCTCTGGCTCAACGTCCCTGACTATGACGCTCCCACACAGCTTGTGAAACCTCTTGAAAGAAACTCCAGGAAA
GTTTATCTTTCAATTCAGCTACCAATTTTGTATGTTGATGCGGTCATGACCATACCTAAAGGAACTCTCTTCCCTATGTG
CGGCATGAACCTTGCTTATGATCGAGAGCTGATTGGTCCAGCTATGTATTTTAGACTCATGGGTGATGGGCAGCCAATAG
GACGCTACGATGACATGTGGGCTGGTTGGTGTGTCAAGGTGATATGTGACCACATGGGATGGGGAGTGAAGACTGGTTTG
CCTTACATATGGCACAGCAAAGCCAGCAACCCATTCGTGAACCTAAGAAAGGAATACAATGGGATCTTCTGGCAAGAAGA
GGCCATACCTTTCTTTCAATCAGTGACTCTTCCTAAAGAATGTGATTCAGTGCAGCAATGCTACATTGAGCTAGCTAAGC
TCGTGAACGAGAAGCTTGGGAAGGTGGATCCTTACTTCATCAAGCTTGCAGATGGAATGGTCACTTGGATCGAAGCTTGG
GAGGAGCTTAACGCTCCAAAAGGAACTGAGACCAATGCACCAAGGGTCACTGAATAA