Details for Kale Locus Bo5g139670

Position : C5 ( 5`- 43462978 .. 43463721 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139670

Protein [Map View]
MTTLLLPQPNRIFKPPLVVPNQRLGKPYRLPVISAVSGQQLVASGEVRAVEPREAKTLVSSEGYVLLDVRPSWEREKAHV
KGSLHVPLFVEDPDNGPITLLKKWIHLGYIGLWTGQRFTMFNDEFTLQVVEAFPDKKSKVLVACGEGLRSLMAISKLHRE
GYKSLGWLTGGFNRATEGDFPEIEGPEELRFATIGGASYYFLKLLVLLPNFGKESR*

DNA
ATGACGACACTTCTTCTTCCTCAACCAAACCGTATTTTCAAGCCACCACTAGTAGTACCAAACCAACGCCTCGGAAAACC
GTACAGATTACCAGTGATCTCCGCCGTATCCGGTCAGCAGCTAGTAGCTTCCGGAGAGGTCCGGGCGGTGGAGCCGAGAG
AAGCGAAAACGTTGGTATCGTCGGAGGGATACGTGCTGTTAGACGTGAGACCGTCGTGGGAAAGAGAAAAGGCACATGTG
AAAGGATCCTTACACGTGCCACTGTTCGTGGAGGATCCAGACAATGGGCCGATCACGCTGCTTAAGAAATGGATCCATTT
GGGATACATTGGGCTTTGGACGGGCCAGAGATTCACCATGTTTAATGACGAGTTTACCCTCCAAGTTGTAGAGGCTTTCC
CGGACAAGAAGAGTAAAGTGCTTGTCGCGTGCGGTGAAGGACTCCGGTCGTTGATGGCAATATCAAAGCTGCACAGAGAA
GGTTACAAAAGCTTAGGATGGTTAACCGGAGGGTTTAACCGAGCAACCGAAGGAGATTTTCCGGAGATTGAAGGTCCGGA
AGAGCTTCGTTTTGCAACTATAGGTGGCGCATCATACTATTTCCTCAAACTACTTGTATTGTTGCCGAATTTTGGCAAAG
AAAGCCGTTGA