Details for Kale Locus Bo5g139660

Position : C5 ( 5`- 43459421 .. 43462577 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139660

Protein [Map View]
MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILMLPADVANRHACRHAIYNGACN
LTLPMKELWLAVYIVDAILVFFVIPFAMFFYEGDQDKSLGKRIKSSLLWVVSTAVVCALVLGILYGVIGKVDFTVRHLAS
GTTSFPTSWQFSNNQPCIGNTARQCSAFTASVASEKTWTMRTTFPEYVVALATIVGSVLFTIFGGVGIASLPLGLITAFI
RRPKAVITRSQYIKEATELGKKARELKKAADGLRQEEKDGAKGRKWRKNVKAVEKELLQLEEDVNLLEEAYPQGEKAETA
WAFTVLGYLAKFILGIIGLIVSIAWVAHIIIYLLVDPPLSPFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMML
GLKLVFITIHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFGHTLQSLRGIKYLYKYNVFQIGF
VILAGLTFLYYITFGWRRKKPSARFQLSS*

DNA
ATGGGCGATTTCAACCTCGCTCTCGTGATTGTCGCGATCGTCGTCTGCGTCATCGTCTTCATCTCCAGCATCTACCTCCT
CGTCAATTACCAGCATCCAGACGACGCGAACCAGGCCTACTTCCCCAAATTCGTCGTCGTCTTCGGCCTCTCCATCGCCA
TGATCTCGATTCTCATGTTGCCGGCGGACGTGGCGAATCGGCACGCTTGCCGGCACGCTATCTACAACGGTGCTTGTAAT
CTCACTTTGCCCATGAAGGAGCTATGGCTTGCCGTTTACATCGTGGACGCTATCCTCGTCTTCTTTGTCATCCCCTTCGC
AATGTTTTTCTATGAAGGCGACCAGGACAAGAGTTTGGGAAAGAGGATAAAAAGTTCCTTGCTTTGGGTCGTAAGCACGG
CTGTTGTTTGTGCTCTGGTGCTTGGAATCTTATACGGTGTTATTGGAAAGGTGGACTTCACTGTCAGGCACTTGGCTTCT
GGGACGACCTCTTTCCCTACTTCATGGCAATTTTCAAATAATCAACCATGTATTGGTAACACCGCTCGCCAGTGCTCAGC
ATTTACAGCTAGCGTCGCGTCTGAGAAAACGTGGACCATGCGTACTACTTTTCCAGAATACGTTGTCGCTCTTGCGACAA
TTGTTGGGTCAGTTCTTTTCACGATATTCGGTGGCGTTGGTATTGCCTCCCTACCATTAGGACTTATCACTGCTTTCATC
CGGCGACCAAAGGCTGTTATTACTCGATCACAATATATAAAGGAAGCAACTGAACTAGGGAAAAAGGCTAGAGAACTAAA
GAAAGCAGCTGATGGACTTCGCCAGGAAGAAAAAGATGGTGCTAAAGGCAGGAAGTGGAGGAAGAATGTGAAAGCAGTTG
AAAAGGAGTTGCTCCAATTGGAAGAAGATGTGAACCTCTTAGAAGAAGCGTATCCTCAAGGAGAGAAGGCAGAAACTGCA
TGGGCTTTTACTGTACTTGGATACTTGGCCAAGTTTATTCTTGGAATCATAGGATTGATCGTTTCCATTGCTTGGGTTGC
ACACATCATCATATATCTACTTGTGGACCCTCCTCTCTCCCCTTTTCTTAACGAGGTTTTCATTAAGCTTGATGACGTTT
GGGGTCTTCTAGGCACTGCCGCCTTTGCTTTCTTCTGTTTCTACCTTCTACTTGCTGTCATCGCTGGGGCAATGATGCTG
GGTTTGAAGCTCGTCTTCATTACCATTCATCCAATGAAATGGGGAGCTACTCTAATGAACTCTTTCCTCTTCAATGTTGG
CCTCATTCTTCTTTGCTCCATCAGTGTGATTCAATTCTGCGCCACTGCCTTTGGATATTACGCACAAGCCACTGCTGCAC
AAGAGATCTTCGGTCACACGTTGCAGTCTCTTAGAGGAATTAAGTACCTCTACAAGTACAACGTGTTTCAAATCGGGTTT
GTTATCCTGGCTGGACTGACCTTTCTATATTACATTACCTTCGGATGGAGAAGAAAAAAGCCAAGCGCCCGTTTCCAGCT
CTCTTCTTAA