Details for Kale Locus Bo5g139650

Position : C5 ( 5`- 43448792 .. 43449744 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139650

Protein [Map View]
MAATSTAAAAASSIMGTRVVSDINSGSGRFTARFGFGTKKAAAPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPF
GLGKPAEYLQFDLDSLDQNLAKNIAGDVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLT
GVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLA
EIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS*

DNA
ATGGCCGCCACTTCAACAGCTGCCGCTGCTGCTTCTTCTATCATGGGTACTCGGGTGGTTTCCGACATCAACTCCGGTTC
AGGCCGGTTCACAGCCCGGTTTGGATTCGGGACCAAGAAAGCCGCTGCTCCCAAGAAGGCTAAGACGGTTATCTCAGACC
GGCCTCTGTGGTTCCCAGGCGCGAAATCTCCCGAGTATCTCGACGGTTCGCTGGTTGGAGACTACGGTTTCGACCCTTTC
GGTTTAGGTAAACCGGCCGAGTATCTCCAGTTTGATCTCGACTCTCTGGACCAGAACTTAGCCAAGAACATAGCCGGAGA
CGTGATCGGGACCCGTACGGAGGCCGTTGACCCCAAGTCAACCCCGTTTCAGCCTTACAGTGAGGTCTTTGGGCTCCAGA
GGTTCAGAGAGTGTGAGCTGATCCACGGGAGATGGGCAATGCTTGCAACTCTCGGTGCTCTCTCCGTCGAATGGCTCACC
GGTGTTACTTGGCAAGACGCCGGCAAGGTAGAGCTAGTGGATGGCTCGTCCTATTTAGGACAGCCATTACCGTTTTCGAT
CTCGACATTGATTTGGATCGAAGTGTTGGTGATTGGTTACATTGAGTTCCAAAGAAACGCTGAGCTGGACTCGGAGAAGC
GCTTGTATCCAGGAGGCAAGTTCTTCGACCCGTTGGGTCTAGCTTCTGACCCGGAGAAGAAGGCTCAGCTTCAGTTGGCT
GAGATCAAACACGCTCGTTTAGCCATGGTTGCCTTCTTGGGATTTGCGGTTCAGGCGGCTGCAACGGGTAAAGGACCGCT
CAACAACTGGGCTACTCACCTTAGTGACCCGCTTCACACCACCATCATTGACACCTTCTCGTCCTCTTGA