Details for Kale Locus Bo5g139630

Position : C5 ( 5`- 43442539 .. 43444493 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139630

Protein [Map View]
MASALCRTASRLRPVQMFRRLRASSDLLSPSSPSPARISDHGDFSLPRSMFTLSCGNERLRMDQRRLLSTSDSGTTSKPS
SGESEAKSSGENEKSGGSEGSDGGGSDQKSDRASGKHARGAPVSWMSFFLLFATGAGLVYYYDREKKRHIEDINTNSKAV
KEGPSAGKAAIGGPFSLIRDDGKRITEKDLMGKWTILYFGFTHCPDICPDELIKLAAAIDKIKEKSGMDVVPVFISVDPE
RDTVQQVHEYVKEFHPKLIGLTGTPEEIKSVARSYRVYYMKTEEEDSDYLVDHSIVMYLMSPEMNFVKFYGKNHDVDSLT
DGVVKEIRQYRK*

DNA
ATGGCGTCTGCTCTATGTAGAACCGCAAGCCGTCTTCGTCCCGTTCAGATGTTTCGCCGACTTCGCGCCTCAAGCGATCT
ACTGTCTCCGTCGTCTCCATCTCCGGCGCGCATCTCCGATCATGGAGATTTCTCTCTTCCTCGATCGATGTTTACACTTA
GCTGTGGAAACGAACGGTTGAGGATGGATCAGAGACGTTTGCTGAGCACTTCTGATTCTGGTACAACCTCTAAGCCTAGC
TCTGGCGAATCGGAAGCGAAATCTTCCGGTGAGAACGAGAAATCTGGTGGATCCGAGGGTTCAGATGGCGGTGGTTCCGA
TCAGAAAAGCGACCGCGCGTCTGGGAAACACGCGCGTGGAGCGCCGGTTTCGTGGATGAGCTTCTTCTTGCTGTTTGCTA
CTGGAGCTGGATTGGTCTACTACTATGATCGGGAAAAGAAACGTCATATCGAAGATATAAATACCAATTCTAAAGCGGTC
AAGGAGGGACCATCAGCTGGGAAAGCAGCTATTGGAGGACCATTCAGCCTTATAAGAGATGACGGGAAACGTATTACGGA
GAAAGACTTGATGGGAAAATGGACAATCTTATACTTTGGGTTCACTCATTGTCCTGATATCTGTCCTGACGAGCTAATTA
AGTTAGCTGCTGCCATTGACAAAATAAAGGAAAAGTCCGGAATGGATGTGGTGCCGGTGTTTATCTCTGTGGATCCTGAA
AGAGATACAGTTCAACAAGTACATGAATATGTCAAAGAGTTTCATCCGAAATTGATCGGGCTGACCGGGACCCCTGAAGA
AATCAAATCGGTGGCTCGTTCTTACCGGGTTTACTACATGAAGACGGAAGAGGAAGATTCAGACTATCTCGTTGATCACT
CTATAGTCATGTACTTGATGAGTCCAGAGATGAATTTTGTGAAATTCTACGGGAAGAATCATGACGTTGACTCGTTGACC
GACGGTGTTGTAAAAGAGATTCGACAGTACCGGAAGTGA