Details for Kale Locus Bo5g139610

Position : C5 ( 5`- 43431996 .. 43434383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139610

Protein [Map View]
MVRTQLVVSVVLVSTLLLLNAEAKTVDPYKVLGVSRDAKPREIQKAFHKQSLKYHPDKNKNKGAQEKFAEINNAYEILSD
EEKRKNYDLYGDEKGQPGFGSGFPGGNGGGYSYSSGGGQGGGGFNFGGPGGWQNMGGGGGGGGGSKSFSFSFGGGGGGPS
ASGSSFGFGMDDIFSMFGGGGGSKGSDQFGGFGGFGGFGGSSKAESGSKRGSVATIKTVSSQVYKKEVVDQGMTWLLLSY
LPSQRGTQYHESVIEEVAESLQGALKVGRINCETESSLCKQLGVVPRRAPRLFVYSYTSSGKATLAEYTEELVSKKVKSF
CQEHLPRFSRRVDLNTFDASAVSSQGIPKVMLLSTKKDTPVIWRVLSGLYNGRFVFYNTEVHDASDPKVKNLGVDAFPAI
VGWLSNGEKQVLKTGITVKNLKSAVQEIGKLLEAFEKKNKKVSSSSQPGQAKSESVEKIHLLSRTNFDSICGGNVPVCIV
GAFRSSQGKEKLHSILSKVSQKSLSRRQASGTGSQDTVSYSLVDAAKQSSFLSSFDKSEFKTSDKVLIAYKPKRGKFATF
KGDMTMEEAEKFVAAVLNGDIQFSKTRQKPQIK*

DNA
ATGGTGAGAACGCAGTTGGTGGTATCTGTTGTGCTTGTCTCGACATTGTTGTTGTTGAATGCAGAAGCGAAAACCGTTGA
TCCCTACAAGGTTCTGGGAGTATCTCGAGATGCAAAGCCGCGTGAAATCCAGAAAGCTTTCCACAAGCAATCTCTGAAAT
ATCACCCAGATAAAAACAAAAACAAGGGTGCTCAGGAGAAGTTTGCTGAGATTAATAATGCTTATGAGATCTTGTCTGAT
GAAGAGAAGAGGAAGAACTATGATCTTTATGGGGATGAAAAGGGACAGCCTGGGTTTGGATCAGGCTTCCCCGGAGGTAA
TGGCGGCGGGTATTCATACTCTTCAGGTGGTGGACAGGGTGGTGGTGGTTTCAATTTTGGAGGACCGGGTGGGTGGCAGA
ATATGGGCGGTGGTGGTGGCGGTGGGGGAGGTTCCAAATCGTTTTCCTTCTCATTTGGCGGTGGTGGCGGCGGTCCTAGT
GCTAGTGGAAGCTCCTTCGGTTTTGGGATGGATGATATCTTTTCCATGTTTGGCGGTGGTGGTGGTTCTAAAGGAAGTGA
TCAGTTTGGTGGATTTGGTGGGTTTGGTGGATTTGGTGGGTCATCTAAGGCTGAGTCTGGGTCAAAGAGAGGTTCGGTTG
CAACTATTAAAACCGTATCATCTCAGGTTTATAAGAAGGAAGTTGTGGACCAAGGGATGACTTGGCTTTTGCTGTCTTAT
CTTCCTTCTCAAAGAGGAACCCAGTACCATGAATCGGTCATAGAGGAAGTTGCTGAGTCACTGCAAGGAGCGTTAAAGGT
TGGGCGTATAAACTGTGAAACAGAATCATCTCTTTGCAAACAACTTGGCGTAGTTCCTCGTAGGGCTCCAAGGCTGTTTG
TTTATTCATACACATCAAGTGGCAAAGCTACCTTAGCAGAGTATACTGAGGAGCTTGTTTCAAAGAAGGTGAAAAGCTTC
TGCCAGGAACATCTACCGAGATTCTCGAGAAGGGTCGACCTGAACACCTTCGATGCCTCTGCTGTTAGCTCACAAGGGAT
TCCGAAAGTTATGCTTTTGTCAACAAAGAAAGACACTCCCGTCATCTGGCGTGTTCTTAGTGGCTTGTACAATGGACGCT
TTGTCTTCTATAACACAGAGGTTCATGATGCTTCTGATCCGAAGGTTAAGAACCTAGGTGTTGACGCATTTCCAGCGATA
GTTGGCTGGTTATCTAATGGGGAGAAGCAAGTCTTGAAGACAGGGATCACTGTGAAAAATCTGAAATCAGCTGTCCAGGA
GATTGGTAAATTGCTAGAAGCATTTGAGAAGAAGAACAAAAAGGTCTCTTCTAGTAGTCAGCCTGGCCAAGCAAAGAGCG
AGTCCGTAGAAAAGATACATCTTCTCTCGAGAACAAATTTTGATTCCATTTGTGGAGGGAACGTTCCTGTTTGTATCGTT
GGTGCTTTCAGATCTTCACAGGGTAAAGAGAAGCTGCACTCAATATTGTCGAAGGTGTCACAGAAGTCTTTGTCTAGACG
ACAAGCTTCAGGAACAGGCTCTCAGGACACGGTTTCATATTCCCTTGTAGACGCGGCAAAACAATCTTCGTTCTTGAGCT
CATTTGACAAATCAGAGTTCAAAACATCTGACAAGGTTCTAATAGCATACAAGCCTAAACGAGGTAAGTTTGCTACGTTT
AAAGGCGACATGACGATGGAAGAAGCTGAGAAATTCGTAGCGGCTGTTCTGAACGGAGACATACAGTTCTCAAAGACAAG
ACAGAAACCTCAGATTAAATGA