Details for Kale Locus Bo5g139600

Position : C5 ( 5`- 43429729 .. 43431027 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139600

Protein [Map View]
MGIQNLLWQVTKKAFTGGIIGVTISDRCCSVVPVRGDSMSPTFNPQRNSYLDDYVLVEKFCLQDYKFARGDVVVFSSPTH
FRDRYIKRIVGLPGEWISSSRDVIRVPEGHCWVEGDNKASSLDSRTFGPIPLGLIRGRVTSVVWPPQRNCMLALFMVCAF
YIIKWVSIQLHVPQDSLWKL*

DNA
ATGGGAATCCAAAATCTTTTATGGCAAGTGACGAAGAAAGCATTCACTGGAGGTATCATAGGGGTTACTATTTCAGATAG
ATGTTGTAGCGTTGTTCCGGTGAGAGGAGATTCCATGTCCCCGACATTCAATCCCCAGCGAAATTCTTATTTAGATGATT
ATGTTTTGGTAGAGAAATTTTGCCTTCAGGATTACAAGTTTGCGCGTGGTGATGTTGTAGTGTTCAGCTCTCCAACTCAT
TTCAGGGATAGATACATAAAGAGGATAGTGGGGCTGCCTGGGGAATGGATAAGTAGTTCACGGGATGTGATCAGAGTCCC
AGAAGGACACTGTTGGGTAGAAGGAGATAACAAAGCTTCCAGCTTGGACTCCAGAACCTTTGGTCCTATTCCTTTGGGTT
TAATTAGAGGACGGGTGACTAGTGTCGTGTGGCCTCCTCAAAGGAACTGCATGCTCGCGCTTTTTATGGTGTGTGCATTT
TATATAATCAAATGGGTCTCTATTCAGCTCCATGTTCCTCAAGATTCTCTATGGAAACTCTAA