Details for Kale Locus Bo5g139580

Position : C5 ( 5`- 43422348 .. 43424649 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139580

Protein [Map View]
MLTHDRDEELSMFLEMRRRDKERRGESLVTGSDHLSISGALTTAAAAALSGVSETVSSQRYPLRRTAAENFLYSENEKSD
YDWLLTPPGTPQFEKESHRSVMEQSDAPSSRPTALKSRLGNYREDIVSGNNNKPQMSSSSSVAGLRRPSSSGSSRSTSRP
STPTRRSTTPTTSTTRPVTTTRASNSRSSTPTSRATLTAARATTSATAPRTTTSRSATPTRTKTQPSSAPSKKPLSRSAT
PTRRSPTPTGPSIVSSKAPSRGTSPTPTPTGPSIVSSKAPSRGTSPTPTPTPTGPSMVSSKAPSRGTSPTPIVNSSKPWK
PREMPGFSLEAPPNLRTSVSDRPVSATRGRPGVASAPGSRSSSIERGNGHTSNGVGHARRQSCSPSRGRAPVGNTNGSLP
GARGRGKANNGDSPVAMGNKMVERVVNMRKLGPPRLTESGGRGTSKSSSAFNSLGYGRNLSKSSIDMALRHMDIRRGMTG
NLRPLVTKVPASSMYSVRSRSNSVTNSPMATSSTVSSSEPNFDNINILCLDGNDAENDDLLSERSFSSPRDQFPKFTS*

DNA
ATGTTGACACACGACAGAGATGAAGAACTCTCTATGTTCCTTGAGATGCGTCGACGCGACAAAGAACGTAGAGGAGAATC
TCTTGTAACAGGATCTGATCATTTAAGTATCAGCGGAGCGTTGACGACTGCTGCTGCTGCGGCGCTCTCTGGTGTCTCCG
AAACGGTGTCGTCTCAACGTTATCCTCTCCGGAGAACCGCCGCCGAGAACTTCTTGTACTCAGAGAATGAGAAATCCGAT
TACGATTGGCTGCTTACGCCGCCGGGCACGCCGCAGTTTGAGAAAGAGTCACATAGGAGCGTAATGGAACAGAGTGATGC
TCCTAGTTCTCGTCCCACGGCTCTTAAATCTCGGCTAGGGAACTACCGTGAAGATATCGTCTCAGGGAACAATAATAAGC
CCCAAATGTCATCGTCCTCCTCTGTAGCTGGACTCAGAAGACCGTCTTCATCAGGTAGCTCAAGGTCGACGAGCAGACCT
TCTACACCAACTAGAAGGTCTACAACCCCAACCACCTCCACAACAAGGCCTGTGACAACCACTAGAGCTTCAAACTCTAG
ATCGTCAACACCCACCTCACGTGCAACATTAACTGCTGCACGTGCTACTACCTCCGCAACGGCTCCACGCACCACAACAT
CTAGATCAGCTACTCCAACTCGGACTAAGACTCAGCCTTCTTCCGCACCTTCTAAGAAACCTTTATCAAGGTCGGCCACG
CCAACCCGCAGGTCTCCAACCCCGACCGGTCCATCAATAGTTTCGAGTAAAGCTCCGTCTCGAGGGACTTCTCCAACTCC
AACCCCAACCGGTCCATCAATAGTTTCGAGTAAAGCTCCCTCTCGAGGGACTTCTCCAACTCCAACTCCAACCCCGACCG
GTCCATCAATGGTTTCTAGTAAAGCTCCGTCACGAGGGACTTCTCCCACTCCAATAGTGAATTCATCGAAGCCTTGGAAG
CCGCGGGAGATGCCTGGTTTCTCTTTAGAAGCCCCACCGAATCTGAGGACATCTGTATCAGATAGACCAGTCTCAGCTAC
AAGAGGCAGACCTGGAGTAGCCTCAGCACCAGGCTCAAGATCAAGTTCCATAGAACGCGGCAACGGCCACACCAGTAATG
GCGTCGGACACGCAAGAAGACAATCTTGCTCCCCGTCAAGAGGCCGGGCTCCTGTAGGGAACACCAACGGGAGCCTGCCA
GGTGCACGTGGGCGAGGAAAGGCCAACAACGGCGATAGCCCAGTGGCTATGGGTAATAAAATGGTCGAGAGAGTGGTGAA
CATGAGGAAACTAGGTCCACCACGGCTAACAGAAAGCGGCGGTCGAGGAACCTCGAAATCTAGCTCTGCTTTTAACAGCC
TTGGCTATGGGAGAAACCTCTCCAAGAGCTCCATCGATATGGCCTTGAGACATATGGATATAAGACGAGGCATGACAGGG
AATCTCCGGCCGCTTGTCACGAAAGTTCCGGCATCATCAATGTACAGCGTGCGAAGCCGGTCGAATAGTGTCACCAACTC
TCCGATGGCTACGAGCAGCACTGTCAGCTCATCCGAACCGAACTTTGACAACATCAACATTTTGTGCTTAGATGGGAACG
ATGCCGAAAACGATGATCTTCTTAGCGAGAGAAGCTTTTCTTCTCCGCGAGACCAGTTCCCCAAGTTCACATCTTGA