Details for Kale Locus Bo5g139570

Position : C5 ( 5`- 43419026 .. 43420246 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139570

Protein [Map View]
MDSEIARKVTAMIDHRRLNRSGSSLFTAFAASVIALIVFTVVIVSNLSVRDISEVVKIEIKTVVPYLPLRSERELSAGKN
NYTIKQITTVKENNNLEILETFGGKGVSEKFQQRATEFLRDDCEVSFMMTWISPVDKFGKRDVLSVESVFKSHPRGCLII
LSSTMDSPQGFRVLKPFLDRGYRVTAVTPDLPFLLKDTAGESWLEEIKTGKRDPGKISLAQNLSNLMRLAYLFKFGGVYL
DTDMIVLKSFKPLRNVIGAQTLEPVSRNWTRLNNAVLVFDKNHPLLRKCIEEFALTFNGNVWGHNGPYLVSRVARAVEGT
VGYNFTVMTPPAFYSVNWIEIGKLFKVPRTEKDRKRVEVKVLEMQRRSYGLHLWNKFSSKFEIEKGSAMDKIVSDHCVIC
EKVSVS*

DNA
ATGGATAGTGAAATAGCTAGAAAAGTCACGGCGATGATTGATCACCGGCGGTTAAACCGCTCCGGATCATCACTATTCAC
AGCCTTTGCTGCCTCAGTAATAGCTCTGATAGTTTTCACGGTCGTCATCGTCTCTAACTTATCGGTGAGAGATATCTCGG
AGGTGGTGAAGATAGAGATCAAGACCGTTGTTCCTTACTTACCTCTGAGATCAGAGAGAGAGCTAAGCGCTGGCAAGAAC
AACTACACGATCAAGCAGATTACCACAGTTAAAGAGAATAACAATCTCGAGATTCTCGAGACTTTTGGAGGCAAAGGCGT
GTCGGAGAAGTTTCAGCAAAGAGCAACAGAGTTTTTGAGAGATGATTGTGAAGTCAGTTTCATGATGACGTGGATCTCCC
CTGTTGATAAGTTCGGTAAGAGAGATGTTTTGTCTGTGGAAAGCGTGTTTAAATCACATCCTCGTGGTTGTTTAATCATT
TTATCATCGACGATGGATTCTCCACAAGGGTTTAGAGTCTTGAAACCGTTTCTTGATCGCGGTTACAGAGTTACTGCGGT
AACTCCTGATTTACCTTTCTTGCTCAAGGACACAGCGGGAGAGTCGTGGCTTGAGGAGATTAAGACAGGGAAGAGAGATC
CCGGGAAGATCTCTTTAGCTCAGAACCTCTCAAACCTCATGAGACTCGCGTACTTGTTCAAGTTCGGGGGCGTTTATTTG
GACACCGACATGATAGTGCTGAAAAGTTTTAAGCCTCTGAGGAACGTGATCGGTGCGCAGACTCTCGAACCGGTTTCGAG
AAACTGGACGAGGCTGAACAACGCGGTTTTGGTCTTCGACAAGAACCATCCTCTCTTGAGGAAATGTATCGAAGAGTTTG
CGTTGACTTTCAACGGGAACGTTTGGGGTCATAACGGACCGTATCTTGTTTCTAGAGTTGCACGAGCTGTTGAAGGAACG
GTTGGTTATAACTTCACTGTCATGACGCCTCCTGCGTTTTATTCGGTTAATTGGATTGAGATTGGGAAGCTCTTCAAGGT
TCCGAGAACCGAGAAGGATAGGAAGAGAGTGGAAGTCAAGGTTCTTGAGATGCAGAGGAGAAGCTACGGGTTGCATTTGT
GGAATAAGTTTAGTAGTAAATTTGAAATTGAGAAAGGTAGTGCCATGGATAAAATCGTTTCGGATCATTGTGTGATCTGT
GAGAAAGTCTCTGTATCATAA