Details for Kale Locus Bo5g139520

Position : C5 ( 5`- 43405570 .. 43406488 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139520

Protein [Map View]
MMNTLQAFQTTLTPNFHVLFNPPRHSLPRTQFLCLSKPRDGNSDSESDPDPPKPEGDTQRQELLARIAMLQTSKVRLTDF
LDERSDYLTKFAEEANAEFDKVGEDAMKDLDEASSRILENIESKMQAFEESAGLNRLEIEENDNKLAEFEEQIVEDRNEG
LFFKSLRDKQPVDLEKAKEETQKIQEVTKESVGSESRRNIYLGLIGIVALAIADSFVSSPDWRKVAVLGAILVPLLTQFV
NEQTLLSEEADKGKGNKKE*

DNA
ATGATGAACACACTTCAAGCATTTCAGACAACTCTAACACCAAACTTCCATGTTCTATTCAATCCCCCAAGACATTCCCT
TCCTAGAACCCAATTCCTCTGTCTCTCGAAACCCAGAGATGGAAACTCGGACTCAGAGTCTGATCCCGATCCTCCAAAAC
CCGAAGGAGATACACAGAGACAAGAACTCTTAGCCAGGATCGCCATGCTTCAAACATCAAAGGTCCGTTTAACTGATTTC
CTGGACGAACGATCAGATTATCTCACAAAGTTTGCTGAAGAAGCCAACGCTGAGTTTGACAAGGTTGGAGAAGACGCCAT
GAAAGACCTCGACGAAGCAAGCTCAAGGATACTAGAGAACATAGAGAGCAAGATGCAAGCATTCGAGGAATCTGCAGGGT
TAAACAGATTGGAGATAGAGGAGAACGATAATAAGTTGGCTGAGTTTGAGGAGCAGATCGTGGAAGACAGGAATGAAGGA
TTGTTCTTCAAGAGCTTACGCGATAAACAGCCTGTTGATTTAGAGAAAGCTAAAGAGGAGACTCAGAAAATACAAGAGGT
TACCAAAGAAAGTGTAGGATCAGAGTCAAGAAGGAACATTTACCTCGGTTTGATTGGGATCGTGGCTCTAGCAATCGCTG
ATTCGTTTGTTTCTTCACCGGATTGGAGAAAAGTAGCTGTTCTTGGAGCTATCCTTGTCCCACTGCTCACTCAGTTTGTG
AACGAGCAGACATTGTTATCAGAGGAAGCAGATAAGGGTAAAGGAAACAAGAAAGAATGA