Details for Kale Locus Bo5g139510

Position : C5 ( 5`- 43395515 .. 43405344 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139510

Protein [Map View]
MVATMDLNASPQPEEDDEPYVRHLEDYSSRDDRIESAVEIARRERDERRKRMRYDKPTHNSQPAYRDQYYQNRNTKAYDR
YKIPQGWLDCPPSGHEIGFLVPSKVPLNEAYNNHVPPGSRYSFKQVVHNQRIAGRKLGLVIDLTNTTRYYSTTDLKREGI
KHVKIACKGRDSVPDNVSVNTFVNEVNQFVLNLKHSKKYILVHCTHGHNRTGFMIVHYLMRSGPMNVTQALKIFSDARPP
GIYKPDYIDALYTFYHEIKPESVICPSTPEWKRSTELDLNGEAVPDDDDDDGGPAGPVQEEPHQVEVKMSNDDVLGDEIP
PDQEEGYRHFFYRMLSLNIGGRGCSQFPGSHPVSLNRDNLQLLRQRYYYATWKADGTRYMMLLTMDGCYLVDRSFRFRRV
QMRFPFKHPTEGISDKVHHFTLLDGEMIIDTLPDKQRQERRYLIYDMVAINGQSVVEVGTVFLSWIFNGWIGSRVLNWLT
GISSIFEYVLKHIVNTVARPFYERWKMLEKEVIDPRNHEKARSHIYRYDLEPFRVRRKDFWLLSAVEKVLKGFIPSLSHE
ADGLIFQGWDDPYVARTHEGLLKWKYPEMNSVDFLYEQDESGRGMLSLFERGKKKHMDGNNVVFRDDSDPAEYSGKIVEC
SWDQDEQVWVSMRVRVDKSTPNDINTYRKVMRSIKDNITEEVLLQEIREIIRLPMYADPPSYLDRLQGNHLECDHMKTHT
RRCLLRFFLFLILSNPSYGENKFRERKATDDEQGYPEIDEDALLNTQCPRKLELRWQTEVTSSVYATPLIADINSDGKLD
IVVPSFVHYLEVLEGADGDKMPGWPAFHQSNVHSSPLLFDIDKDGVREIALATYNGEVLFFRVSGFLMSDKLEVPRRKVH
KNWHVGLNPDPVDRSHPDVHDEQLVHEAMEVKSSATQTHATTTTPNVTVSMPKEFHGEASNVTSQEDQKKPENNQTEAVV
KPTQVTSQEDQKKPENNQTEAVVKPTPVTSQEDQKKPENNQTEAVVKPTPELHNSSMNVSSNNSATNDTTAGSTEKTSGN
VTTNEVDQSKISEAKNETVIKLNTSTDNSSETLVTSGNSSTTETGTKSGRRLLEDGGSDGHSDNKDNNEGVRMATVENDG
ILEADADSSFDLLRDTEELGDEYSYDYDDYVNETMWGDEEWVEGQHENSEDYVNIDAHILCTPVIADIDKDGIQEMVVAV
SYFFDPEYYDNPEHLKELGSIDIKNYIASSIVVFNLETKQVKWVKELDLSTDNSNFRAYMYSSPTVVDLDGDGYMDILVG
TSFGLFYAMDHRGNIREKFPLEMAEIQGAVVAADINDDGKIELVTTDSHGNVAAWTTQGVEIWEVHLKSLVPQGPSIGDV
DGDGHTDVVVPTTSGNIYVLSGKDGSIVRPYPYRTHGRVMNQLLLVDLNKRGEKKKGLTIVTTSFDGYMYLIDGPTSCAD
AVDIGETSYSMVLADNVDGGDDLDLIVSTMNGNITDFTLGSQIHQAWRSTDQGMNNKAIRYDREGVFVTHSTRGFRDEEG
KNFWAEIEIVDNYRYPSGSQAPYNVTTTLLVPGNYQGDRRIKQSQIYNKPGKYRIKLPTVGVRTTGTVMVEMVDKNGLHF
SDEFSLTFHMYYYKLLKWLLVLPMLGMFGLLVILRPQEAVPLPSFSRNRD*

DNA
ATGGTTGCTACGATGGACTTAAATGCTTCCCCACAACCTGAAGAAGATGACGAACCTTATGTGAGGCATCTTGAAGATTA
TTCGTCGCGTGATGACAGGATAGAGTCTGCCGTGGAGATAGCAAGACGGGAACGTGATGAGAGAAGGAAACGAATGAGAT
ATGACAAGCCGACGCATAACTCTCAGCCAGCTTACCGTGATCAGTATTACCAGAATCGAAACACTAAAGCTTATGATAGA
TACAAGATCCCTCAAGGTTGGCTAGACTGCCCTCCCTCTGGGCATGAGATAGGATTCCTCGTTCCTTCCAAAGTTCCCCT
GAACGAAGCTTACAATAATCATGTGCCTCCTGGGAGTAGATACTCTTTTAAGCAGGTGGTCCATAACCAGAGGATAGCTG
GGAGAAAGCTTGGTCTAGTGATTGATTTGACAAATACAACTCGTTACTATTCTACGACAGACTTAAAGAGGGAAGGCATT
AAGCATGTTAAGATTGCATGCAAGGGTCGTGATTCAGTGCCAGATAATGTGTCTGTCAACACTTTTGTCAATGAGGTTAA
TCAGTTCGTCCTAAATCTAAAACACTCAAAGAAGTATATTCTCGTCCACTGTACACATGGACATAATCGGACAGGGTTTA
TGATAGTTCATTATCTTATGCGATCTGGGCCGATGAATGTTACACAGGCATTAAAAATCTTTTCCGATGCCCGCCCCCCT
GGGATCTATAAACCTGACTATATTGATGCTTTATACACGTTTTATCACGAAATAAAACCTGAGAGTGTTATTTGCCCATC
AACTCCGGAATGGAAGAGGTCTACCGAGCTTGATTTAAATGGTGAAGCTGTACCAGATGATGATGATGATGATGGCGGTC
CGGCTGGTCCTGTGCAGGAAGAACCCCATCAGGTGGAAGTCAAGATGTCAAATGATGACGTTTTGGGTGATGAAATACCC
CCTGACCAGGAGGAAGGTTACCGGCACTTCTTTTATAGGATGCTATCGCTGAATATTGGGGGAAGAGGATGTTCGCAATT
TCCAGGTTCACACCCTGTATCCTTAAACAGGGATAATTTGCAACTCTTGAGACAGCGGTACTATTATGCAACATGGAAGG
CTGATGGAACGCGATACATGATGCTGCTAACCATGGATGGATGTTATTTAGTAGATAGGAGCTTTAGGTTCCGGAGAGTA
CAAATGCGGTTCCCCTTCAAACACCCAACTGAAGGCATATCTGATAAAGTGCATCACTTCACATTGCTTGATGGAGAAAT
GATTATAGATACCTTGCCAGATAAACAAAGGCAGGAGAGGAGATATCTAATCTATGATATGGTAGCAATCAACGGCCAAT
CAGTTGTAGAGGTTGGAACTGTCTTTCTTTCTTGGATCTTTAATGGTTGGATTGGTTCCCGTGTTTTAAATTGGCTCACT
GGGATTAGCTCAATATTTGAGTATGTTTTGAAGCACATCGTAAACACTGTAGCACGGCCTTTCTATGAAAGATGGAAGAT
GCTCGAGAAGGAGGTGATAGATCCCCGAAATCATGAGAAGGCAAGAAGTCATATCTACAGATATGATCTTGAGCCTTTTA
GGGTACGGAGAAAAGATTTTTGGTTGCTTTCTGCGGTTGAAAAGGTTTTGAAGGGTTTCATTCCATCACTTTCACATGAA
GCCGACGGTCTTATATTTCAGGGCTGGGATGACCCTTATGTTGCCCGTACCCATGAAGGTCTACTGAAGTGGAAGTATCC
AGAAATGAACTCGGTTGACTTTCTATACGAACAGGATGAGAGTGGCAGGGGAATGCTTTCCTTATTTGAAAGGGGGAAGA
AGAAGCATATGGATGGAAATAATGTTGTTTTTAGAGATGATTCAGACCCGGCCGAGTACTCTGGGAAGATTGTAGAGTGT
TCTTGGGATCAGGATGAGCAAGTCTGGGTTAGCATGCGGGTCAGGGTCGATAAATCAACGCCAAATGATATCAACACTTA
TAGAAAGGTGATGAGAAGCATAAAGGACAACATCACAGAGGAAGTGTTGCTGCAGGAGATAAGGGAGATCATCCGTTTGC
CTATGTACGCGGACCCTCCCTCGTACCTGGATCGGCTCCAAGGTAATCATCTGGAGTGTGATCATATGAAAACCCACACG
CGACGGTGTCTGCTGAGGTTTTTCCTCTTCCTGATCTTATCGAATCCCTCCTATGGGGAAAACAAGTTCAGAGAGCGTAA
AGCCACCGATGACGAGCAAGGCTACCCCGAAATTGATGAAGATGCTTTGTTGAATACTCAGTGCCCGAGGAAACTGGAGC
TGCGATGGCAAACTGAAGTCACTTCTAGTGTTTATGCTACACCTTTGATTGCTGATATCAACAGTGATGGAAAGCTTGAC
ATTGTTGTTCCATCTTTTGTTCACTACCTTGAAGTTCTTGAAGGTGCTGATGGAGACAAGATGCCAGGGTGGCCTGCTTT
TCATCAGTCAAACGTGCATTCAAGTCCTCTTCTATTTGATATCGACAAAGATGGTGTTAGAGAAATTGCTCTGGCGACCT
ACAATGGCGAAGTGCTCTTTTTCAGGGTATCAGGCTTTTTGATGTCAGATAAGCTAGAAGTGCCACGTAGAAAAGTTCAC
AAGAACTGGCATGTGGGACTGAATCCTGACCCTGTTGACCGTTCACATCCTGATGTCCATGATGAACAGCTTGTGCATGA
AGCTATGGAGGTGAAGTCATCGGCCACTCAAACGCATGCAACTACCACAACACCAAATGTTACAGTCTCGATGCCCAAAG
AATTTCACGGCGAGGCTTCAAATGTGACGTCACAAGAGGATCAGAAGAAACCAGAAAATAACCAAACAGAAGCAGTCGTA
AAGCCTACTCAAGTGACGTCTCAAGAGGATCAGAAGAAACCCGAGAACAACCAAACCGAAGCAGTCGTAAAGCCTACCCC
AGTGACGTCTCAAGAGGATCAGAAGAAACCCGAGAATAACCAAACAGAAGCAGTTGTAAAGCCTACTCCAGAGCTACACA
ACTCCTCCATGAATGTTAGCTCGAACAATTCGGCAACAAATGATACTACAGCTGGCTCAACCGAAAAAACCAGTGGAAAT
GTAACCACCAATGAGGTGGATCAAAGCAAGATTAGTGAAGCTAAGAATGAAACTGTTATTAAATTAAATACCAGTACGGA
TAATTCTTCAGAAACTTTGGTGACATCTGGAAACAGTAGTACGACAGAGACAGGAACCAAAAGTGGGAGGCGACTTCTGG
AAGATGGTGGCTCGGACGGCCATTCTGACAATAAAGACAACAATGAGGGTGTTCGCATGGCCACAGTTGAAAACGATGGA
ATATTAGAAGCTGACGCAGATTCATCGTTTGACTTGTTGCGTGATACAGAGGAGTTAGGTGACGAATACAGTTATGATTA
TGACGATTATGTTAATGAGACCATGTGGGGTGATGAGGAATGGGTCGAGGGGCAGCACGAGAACTCAGAGGATTATGTGA
ACATTGACGCCCATATACTGTGCACTCCTGTTATTGCTGACATAGACAAAGATGGAATACAGGAGATGGTTGTTGCTGTT
TCCTATTTCTTCGACCCTGAGTATTATGACAATCCAGAACATCTGAAAGAGCTTGGTAGTATTGACATCAAAAACTATAT
TGCTAGTTCAATTGTGGTTTTCAATCTTGAGACAAAACAAGTTAAATGGGTCAAAGAGCTAGATTTGAGTACGGATAACT
CAAACTTCCGTGCATATATGTATTCTTCCCCAACGGTTGTTGATTTGGATGGCGATGGTTACATGGATATTCTTGTCGGA
ACTTCTTTTGGCTTATTCTACGCCATGGACCACCGTGGAAACATCAGAGAAAAATTCCCACTTGAAATGGCTGAAATACA
AGGGGCAGTGGTTGCAGCTGATATAAATGACGATGGAAAGATTGAACTTGTGACAACAGATTCCCACGGAAATGTAGCAG
CATGGACCACCCAAGGAGTGGAAATTTGGGAAGTACATCTAAAGAGTCTTGTTCCCCAGGGTCCTTCAATAGGCGATGTT
GATGGTGATGGACATACTGATGTTGTGGTTCCTACGACATCAGGAAACATTTACGTTCTTAGTGGCAAGGATGGTTCGAT
TGTCCGTCCTTACCCGTACAGAACTCATGGAAGAGTGATGAACCAGCTTCTTCTTGTTGATCTGAACAAGCGAGGTGAGA
AAAAGAAGGGACTCACCATTGTTACTACATCCTTTGACGGTTACATGTATCTCATAGATGGACCCACCTCGTGCGCTGAC
GCTGTTGATATTGGTGAAACTTCATACAGCATGGTCTTGGCTGATAATGTTGACGGTGGAGATGATCTTGATCTGATCGT
CTCAACTATGAATGGGAACATTACTGATTTCACACTTGGTTCTCAAATTCATCAGGCTTGGAGATCGACTGATCAAGGGA
TGAACAATAAGGCCATCCGTTATGATCGTGAAGGTGTTTTTGTCACGCATTCAACCAGAGGTTTCCGCGATGAGGAAGGC
AAAAACTTCTGGGCTGAGATTGAGATTGTTGATAACTACAGATACCCATCAGGTTCACAAGCACCCTACAACGTTACAAC
GACGCTGTTGGTACCAGGCAATTACCAAGGAGACAGGAGGATAAAGCAGAGCCAGATCTATAACAAACCAGGAAAATACA
GAATAAAACTACCAACCGTTGGAGTCAGGACAACAGGCACAGTAATGGTGGAGATGGTGGACAAGAATGGACTCCATTTC
TCAGACGAATTCTCATTAACTTTCCATATGTATTATTACAAGCTTCTGAAGTGGCTACTTGTCCTCCCGATGCTGGGGAT
GTTCGGTCTGCTCGTGATACTACGACCTCAAGAAGCTGTCCCCCTCCCATCCTTTTCCCGTAACAGAGACTAG