Details for Kale Locus Bo5g139470

Position : C5 ( 5`- 43376040 .. 43377867 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139470

Protein [Map View]
MEFGSSYGTCFEAAKPHLLISTSSKNTNITLRSRTQRFSFRVSSVSYKEFAESALEETRKRTVLEPSPLQERYSSMTGLD
GKTQLQMLAFKSPKIRLLRSMTIENETMQVFDFTGFMKPEYDTPIFCANFFTSANMNIVVLDLNPLLQLTDQTDYQDKYY
KNIMSIYHKYDEIFPWGGKLTGESIKFFSPLVMWTRFSSSQDKHQALFSAFLEYYQAWLEMTIQVKEGMEPSQVRANREA
QHKYLTWRAQKDPGHGLLRKLLGEAKAKALLREFLFNGVDELGTKTFIDYFPEYQTDGGTVSDKRSIIGKSFETRPWDSN
GRFIG*

DNA
ATGGAGTTTGGATCTTCATATGGGACGTGCTTCGAGGCAGCAAAACCTCATCTACTTATCTCGACAAGCTCTAAGAACAC
CAATATCACGTTGAGAAGTAGAACTCAAAGATTCTCATTCAGAGTCTCTTCTGTTTCGTATAAGGAATTCGCAGAGTCTG
CTCTGGAAGAAACCAGGAAGAGGACCGTTCTCGAACCTTCACCTCTCCAGGAAAGGTATAGTAGCATGACAGGGCTTGAT
GGGAAAACCCAACTTCAAATGCTTGCTTTCAAATCTCCAAAGATTAGGCTCTTGCGGAGCATGACCATCGAAAACGAGAC
CATGCAGGTTTTTGACTTTACTGGTTTCATGAAGCCAGAGTATGATACCCCCATATTCTGTGCTAACTTCTTCACATCTG
CCAACATGAACATAGTGGTCTTGGACCTGAATCCTTTGCTTCAGTTAACTGACCAGACTGATTACCAAGACAAGTATTAC
AAAAACATTATGTCCATATATCACAAATATGATGAGATTTTCCCATGGGGAGGTAAACTGACTGGTGAATCCATTAAGTT
TTTTTCCCCTTTGGTGATGTGGACCAGGTTTTCCTCTAGCCAAGATAAACATCAGGCTTTGTTCTCTGCCTTCCTCGAAT
ACTATCAGGCATGGCTTGAGATGACAATTCAAGTGAAAGAGGGGATGGAGCCATCTCAGGTGAGAGCCAACCGTGAAGCA
CAGCACAAATACCTGACATGGCGAGCACAAAAGGATCCTGGACACGGTCTTCTTAGGAAACTACTTGGTGAAGCAAAGGC
AAAGGCGTTGCTGAGAGAGTTCCTGTTCAATGGAGTGGATGAGTTGGGCACAAAAACATTCATTGATTACTTTCCAGAGT
ACCAAACAGATGGTGGAACTGTGAGTGACAAACGAAGCATCATTGGCAAGTCTTTTGAAACTCGGCCTTGGGATTCAAAC
GGACGATTCATCGGCTGA