Details for Kale Locus Bo5g139460

Position : C5 ( 5`- 43374415 .. 43375143 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139460

Protein [Map View]
MFKPMSFDNEVELFGDSKLINEGSSIQLTNSVSGSEGRVVYKEPINLSNSLSFSSYFSFSMPNETDDVMAFVMVPTSLDL
DLFGKKDNSSSALGFLFEHAKNETVVAFEFDISNRGNRARILLGKPESSEVRNLSFEGDLLMMENGGTLSCMIDYEASLK
RMMVRFRKLGTRKMLDPFFDFSVDLGELWNRGEFMVGLSSTNGNSSEAHVLHSWNFDIRHPTPVCLPPPMWMHPQPSEPF
EG*

DNA
ATGTTCAAACCTATGAGTTTCGACAATGAAGTTGAACTTTTTGGAGATTCGAAGCTGATCAACGAAGGCTCTTCGATTCA
GCTGACAAACTCTGTGAGTGGAAGCGAGGGAAGAGTCGTTTACAAGGAACCCATCAATCTTAGCAACTCGTTATCTTTCT
CGAGTTACTTCTCGTTTTCCATGCCTAATGAGACCGATGACGTCATGGCTTTTGTAATGGTTCCAACTAGTTTGGATCTT
GATCTCTTCGGTAAGAAAGACAACAGTTCATCTGCCTTAGGGTTTCTGTTTGAGCATGCAAAGAACGAGACGGTTGTGGC
TTTTGAGTTTGATATTTCCAATAGAGGAAACCGTGCGAGAATCTTGTTAGGTAAACCTGAATCTTCTGAAGTTAGAAACC
TTTCGTTTGAGGGTGACTTGTTGATGATGGAGAATGGAGGGACGTTGAGCTGTATGATTGATTATGAGGCGAGTTTGAAG
AGAATGATGGTTCGGTTCAGAAAACTAGGCACGAGGAAGATGTTGGATCCGTTCTTTGATTTCTCTGTAGACTTGGGGGA
GCTATGGAACCGTGGTGAGTTCATGGTGGGTTTAAGCTCTACGAATGGGAACTCTTCCGAGGCACATGTTCTCCATTCAT
GGAACTTTGACATAAGGCATCCAACGCCGGTGTGTCTTCCTCCTCCTATGTGGATGCATCCTCAGCCGAGTGAACCTTTT
GAAGGATGA