Details for Kale Locus Bo5g139450

Position : C5 ( 5`- 43372421 .. 43373845 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139450

Protein [Map View]
MVKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVKIHAENTGNTAILNL
MPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAP
HMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKFAVAVAAVSADAGGGASAGAAKVEEKKEVVEESDEEDYGGFDMF
GDE*

DNA
ATGGTGAAGGCAACAAAGGCAGAGAAGAAGATCGCTTACGACGCGAAGCTATGCCAGCTCATCGACGAGTTCACCCAGAT
TCTTGTCGTTGCCGCCGACAACGTTGGATCGACTCAGCTCCAGAACATCAGGAAGGGTCTTCGTGGTGACTCGGTGGTGC
TCATGGGGAAGAACACTATGATGAAGCGTTCCGTTAAGATTCACGCCGAGAACACCGGAAACACTGCAATCCTCAATCTG
ATGCCCCTTCTTCAGGGAAATGTTGGTTTGATCTTCACCAAGGGTGACCTCAAGGAAGTGAGTGAGGAAGTTGCCAAGTA
CAAGGTTGGTGCTCCTGCTCGTGTGGGTTTGGTTGCACCTATTGATGTGGTTGTCCAGCCTGGTAACACTGGTCTCGATC
CATCTCAGACATCTTTCTTCCAGGTTCTTAACATCCCAACTAAGATTAACAAGGGTACAGTCGAAATCATCACCCCTGTT
GAGCTCATCAAGCAAGGGGACAAGGTCGGTTCGTCCGAAGCTGCCCTTCTAGCCAAGCTTGGTATCAGGCCGTTCTCCTA
CGGTCTTGTTGTCCAGTCGGTTTATGACAATGGCTCAGTCTTCAGCCCTGAGGTTCTTGATCTTACGGAAGATGACCTTG
TCCAAAAGTTTGCCGCTGGTATCTCCATGGTCACTTCCTTGGCCCTAGCCATCTCTTTCCCTACCCTTGCTGCTGCTCCG
CATATGTTCATCAACGCCTACAAGAATGCATTGGCTATCTCAGTTGCTACTGAGTACACTTTCCCACAGGCAGAGAAGGT
CAAAGAGTTCTTGAAGGATCCTAGCAAGTTTGCTGTTGCTGTAGCGGCTGTGTCTGCTGATGCAGGTGGTGGTGCTTCAG
CTGGAGCTGCCAAGGTGGAGGAGAAGAAGGAAGTGGTTGAGGAATCAGATGAAGAAGACTACGGTGGTTTTGACATGTTC
GGTGATGAATAG