Details for Kale Locus Bo5g139440

Position : C5 ( 5`- 43367661 .. 43371723 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139440

Protein [Map View]
MEGVRVSLVCALLLFVVSSIASAAIVEHTFNVQNLTISRLCKRQVITVVNGSLPGPTVRVKEGDSLVIHVINNSPHNITI
HWHGIFHRLTVWADGPSMITQCPIQPAGHRYAYRFNITGQEGTLWWHAHSSFLRATVYGAIIIRPKSGHSYPFPKPHKEV
PIIFGEWWNTDVVALEEAAIATGVPPNNSDAYTINGLPGNLYPCSKDRMFNLDVVKGKLYLLRIINAAMNMQLFFKIANH
KLTVVAADAVYTKPYLTDVIVIAPGQTVDALLHADQSIGSSYYMAAHPYASTPLVPFPNTTTRGVIHYIGGASKTRRTKR
VLMPKLPSFFDTPTAHRFYSNLTSLVGGPHWVPVPHHVDEEMLVTIGLGLEACAKCPNSKFAASMNNHSFVLPKKLSILE
AVFHGVDGIFTPDFPNQPPVKFDYTDPNITQTSPGLLFVHKSTSAKVLKFNTTVDLVLQNHALLAAENHPMHLHGFNFHV
LAQGFGNYDPTRDRSKYNLVNPQFRNTLAVPVGGWAVTRFRADNPGAWIMHCHIDVHLPFGLGMVFVVENGPTKSTSLPP
PPPDLPRC*

DNA
ATGGAGGGCGTTAGGGTTTCTCTTGTTTGCGCTCTTCTTCTTTTTGTAGTCTCTTCAATAGCTTCTGCAGCCATTGTCGA
ACACACCTTCAACGTACAAAACTTAACCATCTCTCGGCTGTGCAAACGGCAAGTGATAACGGTTGTTAATGGAAGCCTGC
CTGGACCAACGGTACGCGTCAAGGAGGGTGACTCGCTCGTTATACACGTCATTAACAATTCCCCTCACAACATCACAATT
CATTGGCACGGGATATTCCATAGACTGACGGTTTGGGCGGATGGACCGAGCATGATAACGCAATGCCCAATCCAGCCAGC
TGGTCATCGCTACGCTTACAGGTTCAACATCACAGGCCAAGAAGGTACCTTGTGGTGGCACGCACATTCGTCTTTCTTAC
GCGCCACCGTCTACGGTGCTATCATCATCCGCCCTAAATCCGGTCACTCTTACCCGTTTCCCAAACCCCACAAAGAAGTT
CCCATCATATTCGGTGAATGGTGGAACACCGACGTAGTCGCGTTAGAAGAGGCTGCTATCGCCACCGGAGTTCCTCCAAA
CAATTCCGACGCCTATACGATCAATGGCCTGCCAGGAAACCTATATCCATGTTCCAAAGACAGAATGTTTAACCTAGACG
TGGTAAAAGGAAAGTTATATTTACTCCGCATCATAAACGCGGCAATGAACATGCAACTGTTTTTCAAGATAGCCAATCAC
AAGCTGACAGTTGTCGCAGCCGACGCAGTCTACACCAAACCTTACCTCACCGACGTCATCGTCATCGCACCGGGTCAAAC
CGTTGACGCGCTGCTCCACGCCGATCAGTCTATCGGTTCATCCTACTACATGGCGGCTCATCCTTACGCCAGCACACCCC
TCGTGCCGTTCCCCAACACAACCACCAGAGGCGTCATCCACTACATCGGCGGCGCGTCGAAAACACGCAGAACAAAGCGC
GTGTTGATGCCGAAGCTGCCTTCTTTCTTCGACACGCCAACTGCTCACAGGTTCTACTCTAATCTGACAAGCTTGGTCGG
TGGACCACACTGGGTCCCAGTGCCTCACCACGTAGACGAGGAGATGCTCGTAACCATCGGGCTCGGGCTAGAGGCTTGCG
CTAAATGTCCGAATTCGAAATTCGCTGCTTCGATGAACAACCACTCATTCGTCTTACCCAAAAAGCTATCCATCTTGGAA
GCGGTTTTCCACGGCGTGGACGGCATTTTCACGCCTGATTTTCCAAACCAGCCTCCGGTTAAGTTCGATTACACTGACCC
GAACATAACCCAGACAAGCCCGGGACTCTTGTTCGTTCACAAATCAACGAGCGCGAAGGTATTGAAATTCAATACAACGG
TGGATTTGGTGCTGCAGAACCACGCGCTTCTCGCGGCTGAGAATCACCCCATGCATCTCCATGGGTTTAACTTCCACGTG
TTGGCTCAAGGGTTCGGTAATTATGACCCGACCCGTGATCGGAGCAAGTACAATCTCGTCAACCCCCAGTTCCGTAATAC
CTTGGCTGTGCCTGTTGGTGGGTGGGCCGTGACCCGTTTCAGAGCTGATAACCCAGGTGCGTGGATTATGCATTGTCATA
TCGATGTTCACTTGCCATTTGGATTAGGGATGGTGTTTGTGGTTGAGAACGGACCAACGAAGTCGACCAGCTTGCCACCG
CCACCTCCTGATCTTCCGAGATGTTAA