Details for Kale Locus Bo5g139340

Position : C5 ( 5`- 43306390 .. 43308657 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139340

Protein [Map View]
MSFNFNPSSSSSPPPPPDEGERGEEVKKMEEEEEDECVENKQSTAASCSSVSEGSGGGGGSSFLKSPPAVASPPTVSPTH
RRTSGPIRRAKGGWTTEEDETLRRAVCTYNAKSWKKIAEFFPDRTEVQCLHRWQKVLNPDLIKGPWTQEEDEKIVELVKK
YGPAKWSTIAKSLEGRIGKQCRERWHNHLNPGINKEAWTPEEELALMNAHRVHGNRWAEIAKVLPGRTDNSIKNHWNSSL
KKKSEFYQANGALPPSAAKNGVLDSATKRPLFYQRRDSAIQINKPDEDGRHQLNSSAPLEEVVAASPLTSDQLPRPEPSP
ENGYHIYYKNHQTEYSMASEADKQRMYGYECGCSPSASPVIFFTPPPPSRKEYFNGLRPTSPESYLREAARTFPNTPSIF
RKRRRRTVVVVSDSDNKAAKTDEETAKEAVVVVDQKVNEISESPDCEEEKEGNDGSNAYNLSPPYRIRSKRTAVFKSRQL
EFISPEEEKADDDTKSSEKDKVLDGGDSQLPV*

DNA
ATGAGCTTCAATTTCAATCCATCGTCTTCCTCTTCTCCTCCTCCTCCTCCAGATGAGGGAGAAAGAGGTGAAGAAGTGAA
GAAGATGGAGGAGGAGGAGGAGGATGAGTGTGTAGAGAATAAGCAATCAACAGCTGCTTCTTGCTCCTCTGTATCTGAAG
GCAGTGGTGGTGGTGGTGGTAGTAGTTTCCTCAAGTCTCCTCCTGCTGTTGCAAGTCCTCCCACTGTCTCTCCTACTCAT
AGGAGGACGAGTGGACCTATAAGGCGAGCCAAGGGCGGTTGGACTACTGAAGAGGATGAGACATTGAGACGAGCAGTTTG
TACCTATAATGCCAAGAGCTGGAAGAAAATAGCTGAGTTTTTCCCTGATAGAACCGAAGTTCAATGCCTGCACCGATGGC
AGAAAGTTTTGAATCCTGACCTTATTAAAGGACCTTGGACGCAAGAGGAGGATGAGAAGATCGTTGAACTTGTTAAAAAA
TACGGTCCTGCGAAATGGTCTACTATCGCAAAGTCTTTAGAAGGTCGAATTGGGAAGCAATGTCGAGAAAGGTGGCACAA
CCATTTGAACCCTGGTATCAACAAGGAGGCTTGGACCCCTGAGGAAGAGTTAGCTCTCATGAATGCTCATCGAGTCCACG
GAAACAGATGGGCTGAAATCGCTAAGGTCTTACCCGGCAGAACCGATAATTCGATAAAGAATCACTGGAACAGTTCATTG
AAGAAGAAGTCAGAGTTCTACCAAGCTAATGGCGCCTTACCACCTTCAGCAGCAAAGAACGGTGTTCTTGATAGTGCTAC
TAAACGTCCATTGTTTTATCAGAGAAGGGATTCTGCTATACAGATAAACAAACCAGATGAAGACGGAAGACACCAGCTAA
ACTCTTCTGCTCCTCTCGAAGAAGTAGTAGCTGCTTCGCCACTGACCAGTGATCAGTTACCTAGGCCTGAGCCATCGCCG
GAGAATGGTTACCATATTTACTACAAGAACCATCAAACAGAGTATTCCATGGCGTCGGAAGCGGATAAGCAGCGTATGTA
CGGGTATGAATGCGGCTGCAGTCCAAGCGCATCACCTGTTATCTTCTTCACTCCACCGCCGCCTAGTAGAAAAGAGTACT
TTAACGGTTTGCGTCCAACGAGTCCTGAATCTTACCTGAGGGAAGCTGCTAGAACTTTCCCAAACACGCCTTCCATATTC
AGGAAAAGACGACGCAGGACTGTTGTTGTTGTTTCTGATAGTGACAACAAGGCCGCGAAAACAGATGAAGAAACTGCTAA
AGAGGCTGTTGTTGTTGTTGATCAGAAGGTGAATGAGATCTCAGAGAGCCCTGATTGTGAAGAAGAGAAGGAGGGCAATG
ATGGATCAAACGCTTACAACTTGTCTCCTCCATACCGGATAAGATCCAAAAGAACAGCTGTTTTCAAGTCAAGACAGCTT
GAGTTCATCTCTCCGGAAGAAGAGAAGGCTGATGATGACACCAAATCATCTGAGAAAGATAAGGTGCTTGATGGGGGAGA
CTCTCAACTCCCAGTCTAA