Details for Kale Locus Bo5g139320

Position : C5 ( 5`- 43300467 .. 43301323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139320

Protein [Map View]
MNSRLVNENPIVYPKKQGRVRTDQSNTDEDIKDPEHSELTLEDLRVITKESVEVDDAKSYVRVTLTPTLPHCHVPHLIGL
CIYSKLLKSLPTRFKVDVRVAPGSHATEAAVNKQLGDKERIAAALESPYFVDLFN*

DNA
ATGAATTCTAGATTGGTTAATGAGAACCCAATTGTTTACCCTAAGAAACAAGGGCGTGTTCGTACTGATCAGAGCAACAC
GGATGAAGACATCAAAGATCCAGAGCATTCTGAGCTTACACTAGAGGACCTCCGTGTGATTACAAAAGAATCTGTTGAAG
TTGATGACGCCAAGAGTTACGTTAGAGTTACACTCACGCCAACTCTTCCACATTGTCACGTCCCCCACCTTATTGGCCTT
TGTATCTACTCAAAACTTCTTAAAAGCCTTCCTACTCGATTCAAGGTCGATGTTAGAGTGGCACCAGGGAGTCACGCAAC
GGAGGCTGCAGTCAATAAACAATTAGGAGATAAGGAGCGTATAGCGGCAGCACTTGAGAGTCCCTACTTTGTGGATCTTT
TCAACTAA