Details for Kale Locus Bo5g139310

Position : C5 ( 5`- 43295040 .. 43295408 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139310

Protein [Map View]
MSCCGGNCGCGSGCKCGNGCGGCKMYPDLGFSGESTTTETFVFGVAPTMKNQHEASGEGVAENDACKCGSDCKCDPCTCK
*

DNA
ATGTCTTGCTGTGGAGGAAACTGTGGTTGTGGATCTGGCTGCAAGTGCGGCAACGGTTGCGGAGGTTGCAAAATGTACCC
GGACTTGGGCTTTTCCGGCGAGTCGACCACGACTGAGACTTTCGTCTTCGGCGTTGCACCCACAATGAAGAACCAGCACG
AGGCTTCTGGCGAGGGTGTCGCTGAGAACGATGCATGCAAGTGTGGATCTGACTGCAAGTGTGATCCTTGCACCTGTAAA
TGA