Details for Kale Locus Bo5g139290

Position : C5 ( 5`- 43284314 .. 43287656 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139290

Protein [Map View]
MGNGASGCCVAGDTSTRCGVELFHDNLGHSFSYVRPVLDGSRPSFTQEPSLQPDPIPGTTTTFRSISGASVSANNSTSLS
DSLSTDVSLKASGFESSNKFASFPLKPVPRGPTKKQSHVSGPFERRFLSGPIETGLVKKKKKTKSFSKPKPNKRLATFKT
IFTNLISNNQSRSKKSLIEPINSFNSSTSDHHRPEINNSSTSTTLSSQESPRTKEGEDSEEEDDEEEEGKSESSLEEPKI
QWAEGKAGEDRVHVILSEENGWLFVGIYDGFNGPDPPDYLLNNLYTAVLKELKGLLWDDEDNSDDIASCSEDGQSQSQIK
KQSTLEGGTVACDTRKIVSCDSRNIIEDVKKLQWRYASKQNCTESDSEMINHKDVLKALEQALMKTEEAFDQTVDENPVL
ALMGSCVLVTLMKGEDVYVMSVGDSRAVLAQRSYLGRKKMPNDLQRIKEESPLKTCLVREKRVSLLVPVQLNMEHSTNVQ
EEVRRIRNEHSDDPLAIESGRVKGYLKVTRAFGAGFLKQPKWNKAVLEMFRINYVGSSPYITCSPSLHHHRLTPHDKFLI
LSSDGLYEYFSSEEVIFEVESFISAFPEGDPAQHLIQEVLLRAAKKYGMDFHELLEIPQGDRRRYHDDVSVIVISLEGRI
WKSSM*

DNA
ATGGGAAACGGAGCCAGTGGCTGTTGCGTGGCCGGAGACACTTCCACGCGATGCGGCGTCGAACTCTTTCACGACAACCT
CGGCCACTCTTTCAGCTATGTCCGGCCAGTCCTCGACGGATCAAGACCTTCTTTCACGCAGGAACCGTCTCTCCAACCCG
ACCCGATCCCCGGAACCACGACCACTTTCCGTTCAATCTCCGGCGCGTCCGTTAGCGCCAATAATTCAACGTCTCTCTCT
GACTCTCTCTCAACGGACGTGTCGTTAAAGGCCTCCGGGTTTGAGAGCTCTAATAAGTTCGCTTCATTTCCCCTCAAGCC
CGTGCCGCGTGGTCCGACGAAGAAGCAGAGTCACGTGTCCGGTCCGTTCGAGCGACGGTTTTTATCCGGTCCGATCGAAA
CCGGTTTGGTTAAGAAGAAAAAGAAGACCAAATCATTTTCTAAACCTAAACCGAACAAGAGACTTGCCACATTCAAAACC
ATTTTCACAAACTTGATATCTAACAATCAATCTCGCTCGAAGAAGAGCTTGATCGAGCCAATCAACAGTTTCAATTCATC
AACTTCGGATCATCATAGACCTGAGATCAATAACTCAAGTACAAGCACGACTCTGAGCAGCCAAGAGAGCCCTAGAACCA
AAGAAGGAGAAGACTCTGAAGAAGAAGATGATGAAGAAGAAGAGGGGAAGAGTGAGTCTTCTCTAGAGGAGCCAAAGATT
CAATGGGCGGAGGGTAAAGCAGGGGAAGACAGAGTACACGTCATCCTCTCTGAAGAAAACGGTTGGCTTTTCGTGGGAAT
TTACGACGGATTCAACGGTCCAGATCCACCGGATTATCTACTCAACAATCTCTACACCGCCGTGCTCAAAGAGCTCAAAG
GGTTGCTATGGGACGACGAAGACAACTCCGATGATATCGCATCATGTAGCGAAGACGGTCAGTCCCAGTCCCAGATCAAG
AAACAGAGTACACTGGAAGGAGGCACTGTTGCTTGTGACACAAGAAAAATAGTTTCTTGTGACTCAAGAAACATTATTGA
GGATGTGAAGAAGCTGCAATGGAGATACGCTTCGAAACAGAATTGTACAGAATCTGACTCGGAGATGATTAACCACAAAG
ACGTGCTGAAAGCACTTGAACAAGCGTTGATGAAAACAGAGGAAGCGTTTGATCAAACGGTTGATGAGAATCCAGTACTA
GCCTTGATGGGATCCTGCGTTCTCGTGACGTTAATGAAAGGTGAAGACGTTTACGTGATGAGCGTCGGAGATAGCCGAGC
GGTTTTGGCTCAAAGATCTTATCTCGGGCGTAAGAAGATGCCAAATGATCTTCAGAGAATCAAGGAAGAGAGTCCGCTAA
AGACTTGTTTGGTCAGAGAAAAAAGAGTTAGTCTTCTGGTTCCTGTTCAGCTCAATATGGAACACAGCACAAACGTTCAA
GAGGAAGTGAGAAGAATCAGGAATGAACATTCTGATGATCCATTGGCGATAGAGAGTGGTAGAGTGAAAGGTTATCTCAA
GGTCACTCGTGCATTTGGCGCTGGATTTCTCAAACAACCGAAATGGAACAAGGCGGTTCTAGAGATGTTCAGAATAAACT
ACGTTGGATCATCGCCGTACATCACGTGCTCTCCGTCGCTTCACCACCACAGACTCACGCCGCATGATAAGTTCCTTATC
CTCTCATCTGATGGATTGTACGAATACTTCTCGAGTGAGGAAGTCATCTTCGAGGTCGAGTCTTTCATCTCAGCCTTCCC
TGAAGGCGATCCTGCTCAGCATCTCATCCAAGAAGTCCTCCTTCGAGCTGCCAAAAAATATGGTATGGACTTCCACGAAT
TGTTGGAGATACCCCAAGGAGATCGTCGCAGGTACCATGACGATGTTTCTGTCATTGTGATTTCACTCGAAGGAAGAATT
TGGAAATCTTCCATGTGA