Details for Kale Locus Bo5g139280

Position : C5 ( 5`- 43278169 .. 43280774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139280

Protein [Map View]
MAIPRLSSLLRWRKLGKSDWLVASIGFVLFVFFLSFFFDPTSDSVPSVDRSPPIASLPDLVKLTLSSKAKERGAFCLDGS
LPGYHFHKGSGSGSKSWLLHLEGGGWCSSIASCSARAMTMLGSSTYFEDEVDFQGVLSSDPSLNPEFFNWNRVKIRYCDG
ASFAGHPEAEFKNGTRLFFRGQLIWEAIMDELLSMGMSDAKQGILTGCSAGGLATLIHCDYFRDHLPKDAAVKCVSDGGF
FLNVPDVLGHPTMRSFYHDVVNLQGVDKSLDQNCVAKPEPSNCMFPQKFLNNIRTPVFLVNPAYDFWQIQHVLVPASADV
DKSWAKCRLNIKECDVAQMKVLHGFRSSMMDAIGKFHQNKVGGMFIDSCYSHCQTLMSATWHSPTSTRIENKTIAESVGD
WYFNRKPLKLIDCPYPCNPSCYNLNFT*

DNA
ATGGCGATTCCGAGGTTAAGCTCTCTGCTTCGATGGAGAAAACTGGGTAAGAGCGATTGGCTTGTAGCTTCGATAGGATT
CGTATTGTTCGTGTTCTTCCTCTCTTTCTTCTTCGATCCCACTTCAGACTCCGTCCCTTCCGTTGACCGATCTCCTCCCA
TCGCATCCCTACCCGATCTGGTCAAACTGACGCTATCGAGTAAAGCTAAAGAGAGAGGAGCATTTTGCTTAGATGGAAGC
TTGCCTGGGTACCATTTTCATAAGGGTTCAGGGTCAGGCTCAAAGAGCTGGCTTCTTCATTTAGAGGGTGGAGGCTGGTG
CAGTTCAATAGCGTCATGTTCTGCTCGAGCAATGACTATGTTAGGTTCTTCCACCTACTTTGAAGATGAAGTTGACTTTC
AAGGTGTTTTAAGCAGTGACCCTTCTCTAAATCCTGAGTTCTTTAACTGGAATAGAGTTAAGATACGTTACTGTGATGGT
GCTTCTTTTGCTGGACACCCCGAAGCTGAATTCAAGAACGGAACTCGGCTTTTCTTCCGAGGCCAGCTCATTTGGGAGGC
GATTATGGATGAGCTGTTGTCGATGGGCATGTCAGATGCAAAACAGGGCATACTTACAGGATGTTCTGCTGGTGGCTTGG
CAACTCTTATACATTGTGACTACTTTCGAGATCATCTCCCAAAAGATGCAGCTGTCAAATGTGTTTCTGACGGAGGCTTC
TTTCTCAATGTGCCTGATGTCCTTGGACACCCTACGATGAGATCTTTCTATCATGATGTTGTTAACCTGCAGGGCGTAGA
TAAGAGCTTGGATCAGAATTGTGTTGCCAAACCGGAGCCATCCAATTGTATGTTTCCTCAGAAATTCCTTAACAACATAA
GAACACCAGTATTTCTTGTCAACCCAGCTTACGACTTTTGGCAGATTCAACATGTCTTGGTACCAGCTTCTGCTGATGTA
GATAAAAGTTGGGCAAAGTGCAGACTCAATATTAAGGAGTGTGATGTCGCACAGATGAAAGTTCTACATGGTTTTCGTAG
CTCTATGATGGATGCGATCGGGAAGTTTCATCAGAACAAAGTTGGTGGGATGTTCATAGATTCATGCTACTCTCACTGCC
AGACACTTATGTCAGCGACATGGCACTCCCCAACCTCAACAAGAATCGAAAATAAGACTATTGCAGAGTCTGTAGGTGAC
TGGTACTTCAACAGAAAACCGCTGAAGCTAATCGATTGTCCTTATCCGTGCAATCCATCTTGTTACAACCTGAATTTCAC
CTGA