Details for Kale Locus Bo5g139260

Position : C5 ( 5`- 43271872 .. 43274576 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g139260

Protein [Map View]
MRDTTCLERLSLALRTALACLIVSLTTLYGPKPLKNWATFPAFSYLTTILIWLSDAEPTYGEVLKCCVDVSYATFQTAAI
VLVSVLVVGPASLGISFVAPVAVAVASFIVAFPASTSLLTKRIAFGQIVLVYVTFAVFNGEVAHVFMLPVHVAASTALGA
IASLLAVFLPFPRLAHSQMTKGCKLYAENALERLNLFVEVMMARDNTTAQVLIAKAASLSSAARHTLKGIKIHHERLAWE
RPDTRFLKKKQKHQGEKLKATEFLMRGMEIALGSCSSFPLGMSRDEVTNLLEAPRTHIAHEPASTLKPEDRLTWLPEAGS
LSTTSLPVYFFRYCVELFRGDVSSVRQDSKRVDGSFTSKSFLDALSVWMARERFVFAFKCSISLGLAVLFGILYNKKNGY
WSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLLCCVVFQRLEEFRFLPLLPWIAATVFMRHSKVYGQPGGVTSAIA
ALLILGRRNYGAPTDFAITRIVEASIGLLCFVLGEVLVTPARASTLARAELKHCRDAVLDCIGSLVLCSEQKNMPLSDLR
SKQAKLNSHVEALERLTSEALTEPNVPFLKPLNAVSYKKVLVSLSKVSDLCLYVCDGLTNLSGAHPWDQAITHDLKAFQE
KLHSSVKCLEEMASTKTRARLQKELQKRKICHDVEAGTASNDNYSNMELGPSQDDAERFSVSFVKLLKEATEKTSGSTTA
EEVVKNETTLCLSSLGFCISRLMQETVCIMTEITHTT*

DNA
ATGCGTGATACAACATGTCTCGAGCGACTCAGCCTGGCTTTGAGAACCGCCTTGGCTTGTCTCATCGTGAGCTTGACCAC
TTTGTACGGTCCCAAACCACTAAAAAACTGGGCTACGTTTCCAGCCTTCTCTTATCTAACCACAATCTTAATCTGGCTAT
CCGACGCAGAACCAACATACGGTGAAGTTCTCAAATGCTGCGTTGACGTATCTTACGCCACTTTTCAGACAGCAGCCATT
GTGCTTGTGAGTGTCTTGGTGGTTGGACCAGCCTCCCTAGGAATTAGCTTCGTGGCTCCAGTTGCTGTGGCTGTAGCTTC
ATTCATCGTGGCTTTCCCAGCGTCCACGAGTCTTTTAACCAAACGAATTGCCTTTGGGCAGATCGTTCTTGTCTATGTAA
CCTTTGCTGTGTTCAATGGAGAGGTTGCTCATGTTTTCATGCTCCCCGTTCACGTGGCGGCTAGTACAGCACTTGGAGCC
ATTGCTTCTCTACTCGCCGTGTTTCTCCCGTTTCCAAGACTGGCTCATAGTCAGATGACCAAGGGTTGTAAATTATACGC
TGAAAATGCTCTTGAGAGGTTGAATTTGTTCGTCGAGGTCATGATGGCTCGAGACAACACCACAGCTCAGGTGTTGATTG
CAAAGGCCGCTTCATTGTCTTCAGCAGCTAGACACACACTCAAGGGCATCAAAATCCACCATGAGCGTCTTGCATGGGAG
AGACCAGATACAAGATTCTTGAAAAAGAAGCAAAAGCACCAAGGGGAGAAACTAAAAGCCACAGAGTTTCTGATGAGAGG
GATGGAGATAGCGTTGGGATCTTGCAGTTCTTTTCCTCTAGGCATGAGCCGCGATGAAGTGACAAATCTTCTAGAAGCTC
CCAGAACACATATCGCTCATGAGCCAGCATCTACTCTCAAGCCAGAGGACAGGCTGACATGGCTTCCTGAAGCTGGTTCT
CTATCTACAACATCTTTACCAGTTTACTTCTTCAGATACTGTGTGGAGCTCTTCAGAGGTGACGTCTCATCTGTGAGACA
AGACAGTAAACGTGTAGATGGGTCGTTCACGTCCAAAAGCTTTTTGGATGCTCTCTCTGTCTGGATGGCTAGAGAGAGGT
TTGTATTTGCATTCAAATGCTCGATCTCTCTAGGCCTTGCGGTGCTGTTTGGTATACTCTACAACAAAAAAAACGGGTAC
TGGTCGGGTCTAACCGTAGCCATCAGTCTTGTATCCGGAAGGCAAGCGACGCTAACAGTAGCGAACTCTCGCTTACAAGG
AACAGCCATGGGATCAGTCTACGGTCTGTTGTGCTGCGTTGTTTTCCAAAGACTAGAAGAGTTCAGGTTCTTGCCTCTCC
TCCCTTGGATAGCCGCCACCGTCTTCATGAGACACAGCAAAGTCTATGGCCAGCCTGGAGGAGTTACATCCGCCATTGCG
GCGTTGTTGATACTTGGAAGGAGAAACTACGGAGCTCCCACTGATTTTGCTATTACTAGAATTGTTGAAGCTTCGATAGG
GCTGCTTTGTTTTGTCCTTGGGGAGGTTCTTGTCACTCCTGCGAGAGCGTCAACTCTCGCAAGAGCTGAACTTAAACACT
GCCGCGACGCGGTCTTAGACTGTATTGGATCGTTGGTTCTTTGCTCTGAGCAAAAGAACATGCCGTTGTCGGATTTGAGA
AGCAAGCAGGCGAAACTCAACTCTCACGTTGAAGCATTGGAGAGGCTAACGTCAGAAGCCTTGACAGAGCCTAATGTTCC
GTTCCTCAAACCTCTCAACGCGGTTAGTTACAAGAAGGTTTTGGTTTCTCTCTCGAAGGTATCTGATCTCTGTCTCTATG
TTTGTGATGGTCTCACAAACCTATCTGGAGCGCATCCTTGGGACCAAGCCATCACACATGATCTTAAAGCCTTTCAAGAA
AAGCTTCACTCTTCAGTGAAATGCTTAGAAGAGATGGCATCGACCAAGACTCGAGCAAGACTACAAAAAGAGCTGCAGAA
GAGAAAGATATGCCATGATGTTGAAGCAGGAACAGCATCAAACGACAACTATTCAAACATGGAGTTGGGTCCAAGCCAAG
ATGATGCAGAGAGGTTTTCAGTTTCATTTGTAAAGCTACTGAAGGAAGCAACAGAGAAGACGAGTGGTAGCACAACAGCT
GAAGAGGTGGTGAAGAATGAAACTACTCTGTGTCTGAGCAGTCTAGGTTTTTGCATCAGCAGATTGATGCAAGAAACAGT
ATGTATTATGACAGAAATAACTCATACAACTTGA