Details for Kale Locus Bo5g138240

Position : C5 ( 5`- 43262323 .. 43264383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138240

Protein [Map View]
MGNLHGLHRSHHHNAPFPVPSPAHTSSSSTSVPHMTVEPYCHVDSSLRSLAGKAEGFGRAAVGGLNGPVCHVTSLADEGP
GSLREACKRPEPLWIVFDVSGTIHLSSFVNVSSHKTVDGRGKRVKITGKGLRLKQSENVIICNLEFEGGVGPDADAIQIK
PKSSTIWIDRCTLKNYYDGLIDITRESTDITVSRCHFVNHNKTMLIGADPSHVTDRCIRVTIHHCFFDGTRQRHPRVRFA
KIHLFNNYTRHWSIYAVGAGVEAQVYSQCNIYEAGEKKTVFKYITEKAADKEESEAGFIRSEGDWFLNGAKSCLSHDKEH
HVFSPTQHYSGWTVECSTEKLKKYIKHSTGWQNLPLPPDQLPTTA*

DNA
ATGGGAAACTTACACGGCCTTCACAGATCCCATCACCACAACGCCCCTTTCCCAGTACCCTCTCCAGCTCATACATCTTC
ATCGTCAACATCCGTTCCCCACATGACTGTGGAACCTTATTGCCACGTAGACTCAAGCCTCCGCTCCCTCGCGGGAAAGG
CCGAGGGTTTCGGCCGCGCCGCCGTTGGTGGTCTTAATGGTCCGGTTTGCCACGTCACTTCTTTAGCTGACGAAGGTCCA
GGATCGTTACGAGAGGCTTGTAAGAGGCCAGAACCGTTATGGATTGTGTTCGATGTGTCTGGAACGATCCACTTATCTTC
GTTTGTGAACGTATCATCCCACAAAACGGTGGACGGAAGAGGGAAACGGGTGAAGATAACAGGGAAAGGGTTAAGGCTAA
AACAAAGTGAAAACGTTATAATATGTAACCTTGAATTCGAAGGCGGTGTAGGACCAGACGCAGACGCTATTCAGATCAAA
CCAAAATCAAGCACCATTTGGATTGATCGTTGTACTCTCAAGAATTACTATGATGGTTTGATTGATATCACACGAGAAAG
CACTGACATTACTGTCTCAAGATGCCATTTCGTGAACCACAACAAGACGATGTTGATCGGCGCGGACCCAAGTCACGTGA
CGGACCGATGCATAAGAGTTACGATTCATCACTGCTTCTTCGATGGTACACGTCAGCGACACCCTCGTGTTCGCTTCGCA
AAAATACATCTCTTCAACAACTACACTCGTCACTGGTCCATCTACGCTGTCGGAGCCGGCGTCGAAGCTCAGGTATATTC
CCAGTGCAACATATATGAAGCTGGTGAGAAGAAGACTGTGTTTAAGTACATCACTGAGAAGGCTGCCGATAAAGAGGAAT
CCGAAGCTGGTTTTATAAGATCAGAAGGGGATTGGTTCTTGAACGGCGCCAAGTCGTGTCTTAGCCACGACAAAGAGCAC
CACGTGTTCTCTCCGACTCAACACTATTCTGGATGGACCGTCGAGTGTTCAACAGAGAAACTCAAGAAATATATTAAACA
CTCGACTGGCTGGCAGAACCTTCCGCTTCCACCCGACCAACTTCCAACCACAGCATAA