Details for Kale Locus Bo5g138230

Position : C5 ( 5`- 43258260 .. 43261582 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138230

Protein [Map View]
MSLVGRFGSLISQGVYSVATPFHPFGGAIDAIVVQQEDGSFRSTPWYVRFGKFQGVLKGAEKFVKISVNGTEADFHMYLD
NSGEAYFIREVDPAAANDNTENNNGNENNGLRLEHSLSDAGAEREGFNSLSRLDRTESDCNRRYYDFQDDDDDDDPPSPT
SEYGEGQGSDSEVVLVSVDGRILTAPVSAAEQEAENLRLNTPQFHLAPGDGTEFCEGNTEFASSETSWDTEFISKVESSE
KVDSRSRDITVKDSHYTELSQPGENVKSEEPAQNLKEGELLSTAVTENARGEEEVAVETVNTLIDGSESSTTQLTTEEVR
ITEESVDANTESECEDEQTKTSAETAILIESEASERVSIDSTREEDEQLTPSKPNKDSENRNTIDSVAATSSVDIELKYE
LSLCKDELRQGMGLTAAAEVFNTHIISIEEYKNSAASILESENLVVRIRETYMPWKKAARIILGKVAFDLDLDIQPEDVI
SVEENESSKPKDDDEAAATTPSSSGRRWRLWPIPFRRVKTIEHTSSNSSSEEDLFVDSEPGLQNSPEVLSAAESRHESPR
RQLVRTNVPTNEQIASLNLKDGQNMITFSFSTRVLGTQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQFMPLVGKDWT
QSGVAKLFSAIKENGYQLLFLSARAIVQAYLTRSFLNNLKQDGKALPNGPVVISPDGLFPALYREVIRRAPHEFKIACLE
DIRKLFPKDYNPFYAGFGNRDTDELSYRKLGIPKGKIFIINPKGEVATGHRIDVKKSYTSLHTLVNDMFPPTSLVEQEDY
NPWNFWKLPVEEVD*

DNA
ATGAGTTTGGTCGGAAGATTCGGGAGCTTGATTTCTCAAGGCGTTTACTCCGTCGCCACACCGTTCCACCCCTTCGGTGG
CGCCATCGATGCGATCGTCGTCCAACAAGAAGACGGCTCCTTCCGCAGCACGCCCTGGTACGTCAGGTTCGGCAAGTTCC
AAGGCGTTCTCAAAGGCGCAGAGAAGTTCGTGAAGATCTCCGTGAATGGCACCGAAGCTGATTTCCACATGTATCTCGAC
AACTCCGGGGAAGCGTATTTCATCAGAGAGGTTGATCCTGCAGCAGCTAATGACAACACAGAGAATAACAATGGTAATGA
GAACAACGGTTTACGCCTTGAGCATAGTTTATCAGACGCTGGTGCTGAGAGAGAAGGTTTCAACTCTTTGAGTCGGCTTG
ACAGGACGGAGTCTGATTGTAACAGGAGGTATTATGATTTCCAGGATGATGATGATGATGATGATCCGCCTTCTCCTACC
TCTGAGTATGGGGAGGGTCAAGGATCAGACTCTGAAGTGGTTTTGGTGAGTGTTGATGGACGTATACTAACGGCTCCTGT
CTCGGCGGCGGAGCAGGAGGCTGAGAATCTACGGTTGAACACTCCTCAGTTTCATTTGGCTCCTGGCGATGGGACTGAGT
TTTGTGAAGGGAATACTGAGTTTGCTTCCTCTGAGACTTCTTGGGATACTGAGTTTATCAGCAAAGTAGAGTCATCTGAG
AAAGTAGATTCCCGTTCTCGTGATATTACCGTAAAAGATTCTCATTATACTGAACTGTCACAACCTGGTGAGAATGTGAA
GTCTGAGGAGCCAGCTCAGAATCTAAAAGAAGGTGAGCTTCTATCTACTGCAGTCACAGAAAATGCTAGAGGTGAAGAGG
AAGTGGCTGTTGAAACAGTGAATACTCTCATTGATGGTTCTGAATCTTCTACAACTCAACTAACAACAGAAGAAGTGAGA
ATAACTGAGGAATCTGTTGATGCTAATACGGAGTCAGAATGTGAAGATGAACAGACAAAAACTTCTGCAGAAACTGCCAT
CTTAATTGAGTCAGAAGCATCTGAGAGAGTCTCTATAGATTCAACAAGGGAGGAAGATGAGCAACTAACTCCATCGAAAC
CAAATAAGGATAGCGAGAACAGGAACACTATTGATTCAGTAGCTGCAACTTCTAGTGTGGACATAGAACTGAAGTATGAG
CTATCACTTTGCAAGGACGAGCTTCGTCAAGGCATGGGACTCACCGCAGCTGCTGAAGTCTTTAACACGCATATAATCTC
CATAGAAGAATACAAAAACTCAGCAGCATCAATCCTCGAAAGCGAAAATCTAGTCGTTAGGATCAGAGAAACGTACATGC
CATGGAAGAAAGCTGCTCGAATCATACTTGGAAAGGTTGCATTCGATCTAGACTTAGATATTCAGCCAGAGGATGTGATC
TCCGTGGAGGAAAACGAATCTTCAAAGCCCAAGGATGATGATGAAGCTGCAGCAACAACTCCATCTTCGTCCGGAAGAAG
ATGGAGACTCTGGCCTATTCCTTTTAGAAGGGTGAAAACGATCGAGCACACGAGTAGCAACTCCTCGAGCGAAGAGGATC
TGTTTGTTGATTCCGAGCCTGGCTTGCAGAACTCGCCGGAGGTGCTATCAGCCGCGGAGAGCCGCCATGAGTCTCCGCGT
AGGCAGCTTGTGAGAACCAATGTCCCTACTAATGAGCAGATCGCGTCTCTGAATCTGAAAGATGGTCAGAATATGATCAC
TTTTAGTTTCTCCACAAGAGTTCTTGGAACACAACAGGTTGATGCACATATTTACCGGTGGAGATGGGACACTAAGATTG
TAATTTCAGATGTTGATGGGACTATAACTAAATCTGATGTGTTAGGTCAGTTCATGCCTTTGGTTGGAAAGGACTGGACA
CAGTCTGGTGTGGCCAAGCTTTTTTCAGCCATTAAGGAGAATGGATACCAGCTGCTATTTCTGAGCGCTCGTGCCATTGT
TCAGGCATATCTAACAAGAAGTTTCTTAAATAATCTAAAACAGGACGGAAAAGCTCTGCCTAACGGTCCTGTAGTCATTT
CACCAGACGGGCTGTTTCCAGCGTTGTACCGTGAAGTGATAAGAAGAGCACCTCATGAATTCAAGATTGCATGTTTGGAG
GATATCAGGAAACTCTTCCCAAAGGATTACAACCCGTTCTACGCTGGATTTGGGAACAGAGACACTGATGAGCTGAGTTA
CAGGAAACTCGGAATCCCCAAGGGAAAGATATTCATTATCAACCCAAAGGGAGAGGTAGCAACAGGACATCGCATAGATG
TTAAGAAGTCGTACACATCACTTCATACCCTTGTGAACGACATGTTTCCTCCAACTTCACTTGTTGAGCAGGAAGATTAT
AACCCATGGAACTTCTGGAAACTGCCAGTAGAAGAGGTCGACTGA