Details for Kale Locus Bo5g138210

Position : C5 ( 5`- 43252252 .. 43253664 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138210

Protein [Map View]
MPLAISLPTSSPPPHLSPRRHANLRYRRVSVARSSTQENQTGVIIVGAGLAGLAAATRLASQRIPFLLLEASDGVGGRVR
TDIVDGFFLDRGFQIFITAYPEAKKLLDYEALDLQRFYAGAKVFYGGEFHTVADPLRHLLDSVASLTNPIGSVVDKGLIA
LTRARVLIKSDEEILTSAEEVPTIDLLRGIGFSDEILDRFFRPFFGGIFFDRDLETTSKLFDFIFRCLALGENTLPSMGI
GEIPNQLAAKLPADSILMNTRVASLEYPNGSDSGPPIVRLQDGGVLNAELGVVLAVEQPQVDKLLSGIREPVITKPARST
VCIYFTAEPDQIPVQDPVLFLNGTNTGIINNMFFPTNVARTYAPPGKALVSVSLIGSFEDRSDDDLAAEVLRELSGWFGE
SLVTSWRHLRTYRIQFAQPNQCPPTELVKNPRVGSGLYLCGDYMTSATFDGALFSGRRAAEALLLEKGLV*

DNA
ATGCCACTGGCGATCTCTCTCCCAACCTCATCTCCTCCTCCTCATCTCTCCCCTCGCCGTCATGCAAATCTCCGATACCG
ACGCGTCTCCGTAGCTCGATCTTCCACCCAAGAGAACCAGACCGGCGTCATCATCGTCGGCGCCGGACTCGCCGGCTTAG
CCGCCGCCACTCGCCTCGCCTCCCAACGAATCCCTTTCCTGCTCCTCGAAGCTTCCGACGGCGTCGGCGGCCGCGTCCGC
ACAGACATCGTCGACGGATTCTTCCTCGACAGAGGGTTTCAGATTTTCATCACCGCGTACCCCGAAGCCAAGAAGCTTCT
CGATTACGAGGCCCTTGATCTGCAGAGATTCTACGCCGGAGCTAAGGTTTTCTACGGCGGGGAGTTTCACACGGTGGCCG
ATCCTCTCCGTCATTTATTAGACTCAGTGGCGTCTCTAACAAACCCGATCGGATCCGTTGTTGACAAGGGGCTCATCGCG
TTGACGAGAGCTAGGGTTCTGATTAAATCGGACGAAGAGATATTGACTAGCGCCGAAGAAGTTCCGACTATTGATCTCCT
CCGGGGCATCGGTTTCTCCGATGAGATTCTCGATCGGTTTTTCCGGCCGTTCTTCGGCGGGATTTTCTTTGACAGAGACC
TCGAAACGACGTCGAAGCTATTCGATTTTATTTTCAGGTGTCTTGCTCTCGGAGAAAACACGCTTCCCTCCATGGGGATC
GGAGAGATCCCTAACCAGTTGGCGGCGAAACTACCCGCTGATTCTATCTTGATGAACACTAGGGTCGCTTCGTTGGAGTA
TCCAAACGGGTCGGATTCGGGTCCGCCTATAGTGAGACTCCAAGACGGCGGCGTTTTGAATGCAGAGTTAGGTGTTGTAC
TCGCCGTCGAGCAACCCCAAGTGGATAAGCTTCTGAGCGGTATTAGAGAACCGGTTATTACTAAACCGGCTCGGAGCACT
GTTTGCATTTACTTTACAGCTGAACCGGATCAGATACCGGTGCAAGATCCGGTTCTGTTTCTCAACGGGACGAACACCGG
TATCATCAACAACATGTTTTTTCCTACAAACGTTGCTCGGACATACGCGCCGCCGGGAAAGGCTCTGGTTTCGGTATCAT
TGATCGGTTCGTTCGAGGATAGATCCGATGATGATTTAGCAGCAGAGGTTCTCAGAGAACTCTCTGGTTGGTTCGGTGAG
TCTTTAGTTACGTCATGGAGACATTTGAGAACATACCGGATCCAATTTGCTCAACCGAACCAGTGCCCACCCACTGAGTT
GGTTAAGAATCCTCGTGTTGGGTCGGGTCTTTACTTATGCGGTGATTACATGACTTCTGCTACGTTTGACGGTGCTTTGT
TCTCTGGGAGACGAGCTGCGGAAGCTTTGTTACTAGAAAAGGGACTAGTTTGA