Details for Kale Locus Bo5g138190

Position : C5 ( 5`- 43240383 .. 43242942 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138190

Protein [Map View]
MNSSPTRNPTSAEVTPPLSSTSTAAEGSSKKVRKPYTITKSRESWTEEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIR
SHAQKYFLKVQKNGTLAHVPPPRPKRKSAHPYPQKASKNAQMQLQVSTSFTSRNSDMAGGYTSWDDVSMMLNRVISPRQE
LVTLPGAEDDIGSKGLLDVISPSTSGMGSSSRPVSGSEFIVQQPPVLQAVPDFAEVYNFIGSVFDPEKRGHVEKLKEMDP
VNFETVLLLMRNLTVNLSNPDLESSSDCNDACRGTYSHQTR*

DNA
ATGAACTCCTCGCCGACAAGGAATCCGACGTCCGCTGAAGTGACACCACCGTTATCATCAACATCGACTGCTGCGGAGGG
TTCGTCGAAGAAGGTGAGGAAACCTTATACCATCACCAAGTCTAGGGAGAGCTGGACAGAGGAAGAGCACGATAAGTTCT
TGGAAGCGCTTCAACTGTTTGATCGTGACTGGAAGAAGATAGAAGATTTCGTGGGTTCCAAGACAGTTATTCAGATAAGG
AGTCATGCACAAAAATACTTTCTAAAGGTTCAGAAAAACGGGACACTAGCACACGTTCCACCCCCTCGGCCTAAGCGCAA
ATCAGCTCACCCTTACCCTCAAAAAGCATCCAAGAACGCTCAAATGCAACTTCAAGTGTCCACTTCATTTACTAGTCGAA
ATAGCGACATGGCTGGTGGATATACTTCGTGGGATGACGTATCAATGATGCTAAACAGAGTCATTTCACCACGACAGGAA
CTTGTTACTCTTCCTGGAGCAGAAGATGATATTGGATCGAAGGGCTTATTAGATGTTATTAGCCCTTCGACCTCCGGTAT
GGGAAGCTCAAGCCGACCAGTATCAGGTTCTGAGTTTATAGTACAACAACCTCCGGTGCTTCAAGCTGTTCCTGATTTTG
CTGAGGTTTATAACTTCATTGGGAGTGTGTTTGATCCGGAGAAGAGAGGCCACGTGGAAAAGCTCAAGGAAATGGATCCT
GTAAATTTTGAAACTGTTCTGTTATTGATGAGGAACCTCACAGTTAACTTATCAAACCCTGATTTGGAATCCTCATCTGA
CTGTAATGATGCCTGCAGAGGAACGTACTCTCATCAGACGAGGTGA