Details for Kale Locus Bo5g138180

Position : C5 ( 5`- 43236687 .. 43239412 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138180

Protein [Map View]
MEEDERSKSRKEDYEMKAKNRRDRYRDRGKDQKKGNGSEKNRRKRREKPKEKDKDRRRSGSDRFKSGTEEKGRRYREHGR
NREVEDGVKQLDEEAEKRRRRLHEWQELKKKKEEAESESKSWTLEGDSDDDQGPPHGGDAYKMVDVVSENEEVIDPLHAF
MNTMVLPEVEKLSNAASPLGEDSDYSETKDDDDQPSLDKGDEVFMKTLKKTKGDKLTLVDHSNIEYQPFRKNFYIQVKDI
SNMTEQEVNTYRKELEIKVHGKDVPRPIKSWHQTDLTTRILNTIKKLNFQNPTPVQSQPLPIIMSGRDCIGVAPTGSGKT
LSFVLPMLRHIKDQPPVEPGDGPIGLVMAPTRELVQQIHTDIKKFAKSLSIRSAAVYGGSGVAQQISELRRGTEIIICTP
GRMIDILSTNSGKVTNLQRVTFLVMDEADLEALARKVLNKPVEIQAGGRSVANKDITQFEKCDGLYNDLKNKCGYRCQSL
HGGKDQILREVAVSEFKSSVCNLLVATSVAARGLDVKGVELVVNFDAPNHYEEYVHRVGRTGRAGRKGCAVTFVSEDDAK
YAPDLVKALERSEQVVPDGLKAMADGFMERVREGVEKGHGSGFGGSGFKFNDEEDVRRAAKEAQKKEDGIEEEDKSELED
ENGGGEISQQKQEATMVVAAMLRGCARTRQQYEAELEINDFPQNARWKVTRRETLGSISDWSGAAITTRGQFFTPGRSPG
PGERKLYLFVEGPSEESVKAAKGELMRVVNDVTNQALSFPGRSQHGRYSVL*

DNA
ATGGAGGAGGACGAGAGATCTAAATCCAGGAAGGAAGATTACGAAATGAAGGCGAAGAATCGCCGAGATCGTTACCGTGA
TCGCGGTAAGGACCAGAAGAAGGGGAACGGTTCAGAGAAGAACCGGCGCAAGAGACGGGAGAAGCCTAAAGAAAAGGACA
AGGATCGGAGACGGAGCGGTTCTGATAGGTTTAAAAGCGGAACGGAAGAGAAGGGAAGAAGATACCGAGAACATGGGAGA
AATAGAGAAGTAGAGGATGGGGTTAAGCAGTTGGATGAGGAGGCAGAGAAACGTAGGAGAAGATTACATGAGTGGCAAGA
ACTGAAGAAGAAAAAGGAGGAAGCTGAAAGCGAAAGCAAGTCTTGGACTCTCGAAGGAGATTCTGATGATGACCAAGGCC
CTCCCCATGGTGGTGATGCTTATAAGATGGTAGACGTTGTCTCTGAGAACGAAGAGGTAATTGATCCTTTACATGCTTTT
ATGAATACCATGGTTTTACCTGAGGTTGAGAAGCTTAGCAACGCTGCTTCTCCTCTAGGTGAAGATTCTGACTATTCAGA
GACAAAGGATGATGATGATCAACCTAGTTTGGACAAAGGAGACGAGGTCTTCATGAAGACACTAAAGAAGACAAAAGGAG
ATAAACTAACTCTTGTTGACCATTCAAACATAGAGTACCAACCTTTCCGTAAGAACTTCTACATCCAAGTGAAAGACATC
TCAAACATGACAGAACAAGAAGTCAACACTTACAGAAAAGAACTAGAGATAAAAGTCCACGGAAAAGACGTACCAAGACC
CATCAAATCATGGCACCAGACCGACCTAACCACCAGAATCTTGAACACAATCAAGAAACTCAACTTCCAAAACCCAACTC
CTGTCCAATCACAACCCCTCCCAATCATAATGTCCGGTCGAGACTGCATCGGAGTCGCACCAACCGGGTCAGGCAAAACC
CTCAGCTTCGTTCTACCAATGCTAAGACACATCAAAGACCAGCCTCCCGTCGAACCCGGCGACGGGCCCATTGGGCTTGT
AATGGCACCAACCAGAGAGCTAGTCCAGCAGATTCACACCGATATCAAAAAGTTCGCTAAGTCACTGAGTATCAGATCAG
CGGCAGTATACGGAGGTTCAGGAGTTGCTCAGCAGATCAGCGAGCTTAGGCGAGGGACTGAGATAATAATCTGCACTCCT
GGTAGAATGATTGATATTCTCTCCACAAACAGTGGGAAAGTAACCAATCTCCAAAGAGTAACGTTTCTTGTAATGGATGA
AGCTGACCTCGAGGCTTTAGCTCGCAAAGTCCTGAACAAGCCTGTTGAGATACAGGCGGGCGGGAGGAGCGTCGCGAATA
AAGATATAACTCAGTTTGAGAAATGCGACGGTTTGTATAACGATTTGAAGAATAAATGTGGTTACCGTTGCCAATCTCTC
CACGGAGGGAAAGATCAGATTCTTCGCGAGGTGGCTGTTTCTGAGTTTAAGAGCAGTGTTTGTAATTTGCTGGTTGCTAC
TAGCGTTGCGGCTAGAGGTTTGGACGTGAAGGGGGTTGAGTTGGTTGTGAACTTTGACGCTCCGAATCATTATGAGGAGT
ATGTGCATCGCGTTGGTCGGACGGGGAGGGCGGGGAGGAAAGGGTGCGCCGTGACGTTTGTGTCCGAGGATGATGCCAAG
TACGCGCCGGATTTAGTTAAAGCTTTGGAACGGTCTGAGCAGGTTGTTCCTGATGGTTTGAAAGCGATGGCTGATGGTTT
TATGGAGAGGGTGAGGGAAGGTGTTGAGAAGGGTCATGGAAGTGGTTTTGGCGGGAGTGGTTTTAAGTTTAATGACGAGG
AGGATGTTAGGAGAGCAGCGAAGGAGGCGCAAAAGAAGGAGGATGGTATTGAGGAAGAAGACAAGTCTGAGTTGGAAGAT
GAGAACGGTGGTGGTGAGATCTCACAGCAGAAGCAGGAGGCTACTATGGTTGTTGCTGCTATGCTGCGAGGTTGTGCAAG
GACTCGACAACAGTATGAAGCTGAACTGGAGATAAATGATTTCCCACAGAATGCTCGTTGGAAGGTGACGCGGAGAGAGA
CTCTTGGTTCGATATCGGATTGGTCTGGAGCGGCTATTACTACCAGAGGTCAGTTTTTCACGCCGGGACGTAGCCCGGGC
CCTGGGGAACGCAAGCTTTACTTGTTTGTTGAAGGACCTAGCGAGGAATCTGTTAAGGCGGCCAAAGGTGAGCTCATGCG
TGTTGTTAATGACGTTACTAATCAAGCCTTGTCGTTTCCCGGAAGATCACAACATGGTAGATACTCCGTCTTATAA