Details for Kale Locus Bo5g138170

Position : C5 ( 5`- 43234656 .. 43236230 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138170

Protein [Map View]
MATSAARPLVTIQGLDGDMTTDQSSTIVLPDVMTAPVRPDIVSFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSR
IPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRKWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVS
DSAEAVEKTAAAIKVLKQIGAYDDAEKAKDSIGIRSGVGKMRNRRYICRKGPLVVYGTEGSKIVKAFRNLPGVELCHVER
LNLLKLAPGGHLGRFVVWTKSAFEKLEGIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEVQSVVKPIKKDAKRAVM
KKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLTKKRKTVTKEESLAIKAAGKAWYQTMISDSDYTEFDNFTK
WLGASQ*

DNA
ATGGCTACCTCCGCCGCACGTCCTCTCGTCACCATCCAAGGCCTCGACGGCGACATGACCACCGACCAATCCTCCACCAT
CGTCCTCCCCGACGTCATGACGGCCCCCGTCCGCCCCGACATCGTCAGCTTCGTCCACGCTCAAATCTCCAACAACAGCC
GCCAGCCCTACGCCGTCTCCAAGAAGGCCGGTCACCAGACCTCCGCCGAGTCGTGGGGAACCGGACGCGCCGTCTCCCGT
ATCCCCCGTGTCCCCGGAGGAGGTACTCACCGCGCAGGACAAGCAGCCTTCGGTAACATGTGTCGCGGCGGACGCATGTT
CGCTCCGACCAAGATCTGGCGCAAATGGCACAGGCGCGTGAACGTCAACATGAAGAGGCACGCGATCGTCTCGGCCATTG
CTGCGACTGCTGTTCCCGCGCTTGTGATGGCGCGTGGGCATAAGATCGAGAATGTCCCCGAGATGCCTCTTGTGGTGAGT
GACTCTGCCGAAGCCGTGGAGAAGACGGCAGCTGCTATCAAGGTTTTGAAGCAGATTGGTGCTTACGATGATGCCGAGAA
GGCGAAGGATAGTATTGGGATTAGGTCTGGTGTGGGGAAGATGAGGAACCGTCGTTACATTTGTCGGAAAGGTCCTCTTG
TGGTTTACGGAACCGAAGGGTCTAAGATTGTGAAGGCGTTTAGGAACTTGCCTGGTGTTGAGCTTTGCCACGTGGAGAGG
CTTAACTTGTTGAAGCTTGCTCCTGGTGGTCATCTTGGGAGGTTTGTGGTTTGGACCAAGTCGGCTTTCGAGAAGCTTGA
GGGGATCTATGGATCGTTTGAGAAGCCGTCGGAGAAAAAGAAGGGGTATGTGCTTCCTAGGGCGAAGATGGTGAATGCTG
ACTTGGCGAGGATTATTAACTCTGATGAGGTGCAGAGTGTGGTGAAGCCGATTAAGAAGGATGCGAAGAGGGCTGTGATG
AAGAAGAATCCTTTGAAGAATCTGAATGTGATGCTGAAGTTGAACCCGTATGCTAAGACCGCCAAGAGGATGTCGTTGTT
GGCGGAGGCGCAGAGGGTTAAGGCTAAGAAGGAGAAGCTCACCAAGAAGAGGAAGACTGTCACCAAGGAGGAGTCACTGG
CGATCAAGGCCGCAGGGAAGGCGTGGTACCAGACTATGATCTCCGACAGCGACTACACCGAGTTCGACAACTTCACTAAA
TGGCTCGGTGCTAGCCAGTAA