Details for Kale Locus Bo5g138160

Position : C5 ( 5`- 43231732 .. 43234065 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138160

Protein [Map View]
MNILRPLPTSSSSFPPYTNSAIVTAAAAFTTTHNPISLCSINPPPFTAAGLPTRRHFFARSASGTANSSAGDLSSFLGSS
PEAYSTHNDQELLSLLRSRRTDEAWAKYVQSTHLPGPTCLSRLVSQLSYQSKPESLTRAQSILTRLRNERQLHRLDANSL
GLLAMAAAKSGQTLYAVSVIKSMLRSGYLPHVKAWTAAVANLSAAGDDGPEESIKLFTAITRRVRRFGDQSLVAQSRPDT
AAFNAVLNACANIGDTEKYSKLFGEMSEWDCEPDVLTYNVMIKLCARVGRKELIVFVVERIIEKGVKVCMTTMHSLVAAY
VGFGDLRTAERIVQAMREKRRDLCKVLRECNGEDLKEKEEEEEEEDAFEDDEGLVYTPRHEVIEEGSEDVFKKLLPNSVN
PSDEPPLLPKAFAPDSRIYTTLMKGYMKNGRVADTARMLEAMRRQDDKNSHPDEVTYTTVVSAFVKAGLMDRARQVLAEM
ARMGVPANRITYNVLLKGYCKQLQIDKAEDLLREMAEDAGIEPDVVSYNIIIDGCILIDDSAGALSFFNEMRTRGIAPTK
ISYTTLMKAFAMSGQPKLANRVFDEMMRDPRVKVDLIAWNMLVEGYCRLGLIEDAKRVVSRMKENGFHPNVATYGSLANG
VSLARKPGEALLLWKEIKERCVVKKREESEGDSSPPMLKPDEGLLDMLADICVRAAFFKKALEIIACMEENGIPPNKTKF
KKIYVEMHSRMFTSKHASQARVERRVERKRAAEAFKFWLGLPNSYYGSEWKLGPRED*

DNA
ATGAACATTCTCCGACCTCTTCCGACTTCATCGTCGTCATTTCCTCCATACACAAACTCCGCTATAGTAACCGCGGCGGC
GGCTTTCACTACCACCCACAACCCCATATCCCTCTGCTCAATCAACCCACCACCATTCACAGCCGCTGGTCTCCCCACAC
GCCGCCACTTTTTCGCACGGTCCGCTTCCGGAACTGCCAACAGCTCCGCCGGAGACCTCTCATCGTTCTTGGGCTCTTCT
CCAGAAGCCTACTCAACGCACAACGACCAAGAGCTTCTGTCTCTCCTGCGCAGCAGAAGAACCGATGAAGCTTGGGCCAA
GTACGTTCAATCCACTCATCTCCCTGGTCCCACTTGTCTTAGCCGTTTAGTTTCACAGTTGTCTTATCAATCCAAACCCG
AGAGCCTCACGCGCGCGCAGTCTATCCTCACGCGCCTCCGCAATGAGCGCCAGCTCCATCGTCTGGACGCCAACTCCCTC
GGCCTCCTCGCCATGGCCGCCGCGAAGTCCGGCCAAACGCTTTACGCCGTCTCCGTCATCAAGTCAATGCTCCGTTCTGG
GTACTTACCACACGTTAAGGCGTGGACAGCTGCAGTAGCTAACCTCTCTGCTGCTGGAGACGATGGACCTGAAGAGTCTA
TCAAACTCTTTACAGCTATCACACGAAGAGTCAGACGCTTTGGAGATCAATCTTTGGTCGCTCAGTCTAGGCCTGATACG
GCTGCGTTTAACGCTGTGCTTAACGCTTGTGCGAATATCGGTGATACTGAGAAGTACTCGAAGCTGTTCGGTGAGATGTC
TGAGTGGGATTGTGAGCCTGATGTGTTGACTTATAATGTAATGATCAAGCTTTGTGCGAGAGTTGGTCGGAAGGAGCTGA
TTGTGTTTGTCGTGGAGAGGATTATTGAGAAGGGAGTTAAGGTTTGTATGACTACGATGCATTCACTTGTAGCAGCTTAT
GTTGGTTTTGGAGATTTGAGAACTGCGGAGAGGATTGTTCAAGCGATGAGGGAGAAAAGGAGAGATCTTTGCAAGGTTTT
GAGAGAATGTAATGGAGAGGATTTGAAGGAGAAAGAAGAGGAAGAAGAAGAAGAAGATGCGTTTGAGGATGATGAGGGTT
TAGTTTATACTCCTCGGCATGAAGTAATCGAAGAAGGGTCTGAGGATGTGTTCAAGAAGTTGCTGCCTAACTCAGTTAAC
CCGAGTGATGAGCCTCCACTGTTGCCTAAAGCCTTTGCTCCTGACTCGAGAATCTACACAACGTTGATGAAAGGTTACAT
GAAGAATGGGCGTGTGGCGGATACAGCTAGAATGCTAGAGGCGATGAGACGTCAAGATGATAAAAATAGCCACCCGGATG
AAGTTACCTACACCACGGTTGTGTCAGCTTTTGTAAAAGCCGGGTTGATGGATAGAGCACGACAAGTGTTAGCTGAGATG
GCTAGGATGGGTGTACCTGCGAATAGGATCACATACAACGTCCTCCTCAAAGGGTATTGCAAGCAGCTGCAGATAGATAA
GGCAGAGGATTTGCTAAGGGAGATGGCTGAAGATGCAGGGATCGAGCCAGACGTTGTGTCCTATAACATCATCATAGATG
GATGCATTCTTATAGATGACAGCGCAGGAGCTTTATCGTTCTTCAATGAAATGAGAACTAGAGGGATTGCACCAACTAAG
ATTAGTTACACTACTTTGATGAAGGCTTTCGCAATGTCGGGGCAACCAAAGTTGGCGAACAGGGTGTTTGATGAGATGAT
GAGGGATCCAAGGGTCAAAGTTGATTTGATTGCGTGGAACATGTTGGTTGAAGGGTACTGCAGGCTTGGTTTGATTGAAG
ATGCGAAGAGAGTAGTTTCGAGAATGAAAGAAAACGGGTTTCACCCGAACGTGGCGACTTACGGGAGCCTAGCCAACGGG
GTTTCTCTGGCGAGGAAGCCTGGTGAGGCGCTCTTGCTATGGAAGGAGATAAAGGAAAGGTGTGTGGTGAAGAAGAGGGA
AGAATCTGAAGGAGATTCTTCTCCTCCGATGCTGAAGCCTGATGAAGGGTTGTTAGATATGTTAGCGGATATATGTGTGA
GAGCTGCGTTTTTCAAGAAAGCATTGGAGATCATCGCCTGCATGGAGGAGAATGGGATACCTCCGAACAAAACTAAGTTC
AAGAAGATCTATGTGGAGATGCACTCGAGGATGTTCACTAGCAAACATGCTTCACAAGCAAGGGTAGAGAGGAGGGTGGA
ACGAAAGAGAGCGGCTGAAGCTTTCAAGTTTTGGCTTGGTTTGCCTAATTCTTACTATGGCAGTGAGTGGAAGTTAGGTC
CAAGAGAAGACTAG