Details for Kale Locus Bo5g138150

Position : C5 ( 5`- 43226735 .. 43231469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138150

Protein [Map View]
MGVYGDGSDGASMTSRRRGSIGVDSVDIAKILAVYFRDNENSCIDEEKLMLTAELIRIFSSPSGRDLVSQVSEDGGGSFS
LPLDLQQFKKLCDIENFFLNLEDNPKGVLPCMNAAVHKVLLSQWETNGFDDVMKINIRLHNYPESSISLKNLRAAYIGKL
VTVHGTVVKVSTVKPLVTQMAFDCAKCKTSITREFTDGKFSPPQNCDTHGCKSKMFIPLRSSAQTIDFQKIRVQELQKPE
DHEEGRVPRTVECELMEDLVDTCIPGDVVTVTGIIGVINNYMDIGGGIDFITLYGKSKSKNQGFYYLFIEAVSVKNSKKQ
SAFENSEDSGSGVQSADVGDLYSFSQRDLEFIVKFNEEYGSDTFRRILHSVCPSIYGHEIVKAGITLSLFGGVRKHSMDR
NKVPVRGDIHVIIVGDPGLGKSQLLQAASAISPRGIYVCGNATTKAGLTVAVVKDSMTNDYAFEAGAMVLADGGVCCIDE
FDKMTNEHQALLEAMEQQCVSVAKAGLVASLSARTSVIAAANPVGGHYNRAKTVNENLKMSAALLSRFDLVFILLDKPDE
LLDKQVSEHIMSLHSGGGEAPPALKKFKTASGSANVHAKEGSLLSRLRLDPKKDDDFTPIPGQLLRKYVAYARTFVNPKM
SKAAGEIIQKFYLKLRDHNTSADSTPITARQLESLVRLAQARARVDLREDITVQDAMDVVEIMKESLYDKFVDEHGVVDF
GRSGGMSQQKEARRFLSALDKQSELQQKDCYSVSEMYSLADRIGLRVPDIDTFLENLNTAGYLLKKGPKTYQVLSSSYSR
SQSSRSR*

DNA
ATGGGTGTATACGGAGACGGGAGCGACGGGGCAAGCATGACGTCGAGACGCCGTGGATCAATCGGCGTTGATTCCGTCGA
TATTGCGAAGATATTAGCTGTGTATTTCAGAGACAACGAGAACTCGTGCATCGACGAGGAGAAGTTGATGCTCACGGCGG
AGCTTATCCGCATATTCTCTTCGCCGAGTGGTAGAGACTTAGTTTCTCAGGTGAGTGAAGATGGTGGTGGTTCCTTCTCT
TTACCGCTTGATCTCCAACAGTTCAAGAAGTTATGCGATATCGAGAATTTTTTCCTTAATTTGGAGGATAATCCCAAAGG
AGTTTTACCATGTATGAATGCTGCAGTTCACAAGGTTCTCTTAAGTCAATGGGAGACTAATGGCTTTGATGATGTTATGA
AGATCAATATTCGTCTGCATAACTATCCTGAATCTTCAATCTCTCTGAAAAACCTGAGAGCAGCATATATTGGTAAGCTT
GTAACAGTTCATGGGACCGTTGTTAAAGTTAGTACTGTGAAGCCTCTTGTCACACAGATGGCTTTTGACTGTGCAAAGTG
TAAAACTAGCATTACCCGGGAATTTACTGACGGAAAGTTTTCACCTCCGCAAAACTGTGACACCCATGGATGTAAGTCCA
AGATGTTTATTCCACTCCGATCCTCTGCTCAGACAATTGATTTTCAGAAAATCAGGGTTCAGGAGTTGCAAAAGCCTGAA
GACCATGAAGAAGGACGGGTACCCCGAACTGTTGAATGTGAGCTGATGGAAGACCTTGTGGACACATGCATCCCTGGTGA
TGTGGTGACTGTTACAGGGATTATAGGTGTAATTAACAATTACATGGATATTGGGGGAGGTATTGATTTTATAACTCTTT
ATGGGAAATCGAAGTCCAAGAATCAAGGATTCTACTATTTGTTTATAGAGGCAGTTTCAGTTAAAAACTCTAAGAAGCAG
TCTGCATTTGAGAACTCAGAAGACTCCGGTAGTGGTGTCCAGTCTGCAGATGTTGGTGATTTATATTCATTCTCACAGAG
AGACTTGGAATTTATTGTTAAGTTCAACGAAGAATATGGTTCTGATACATTCCGTCGCATACTTCATTCAGTTTGCCCAT
CTATTTATGGGCATGAAATTGTCAAAGCTGGGATAACTCTATCCCTGTTTGGAGGTGTAAGGAAGCATTCGATGGATCGG
AACAAAGTTCCAGTCAGAGGAGACATTCATGTCATTATTGTTGGCGACCCTGGATTGGGAAAAAGTCAACTCTTGCAAGC
AGCATCGGCCATCTCCCCTCGTGGCATCTATGTATGTGGTAATGCGACGACTAAAGCAGGGCTCACCGTTGCTGTAGTGA
AAGATTCTATGACAAATGACTATGCGTTTGAGGCTGGTGCCATGGTACTTGCAGATGGCGGGGTTTGCTGCATTGACGAG
TTTGATAAAATGACCAACGAGCATCAGGCTTTGCTAGAAGCAATGGAACAACAATGTGTCTCTGTTGCCAAGGCTGGGCT
TGTGGCTAGTCTATCAGCTCGGACTTCTGTTATAGCCGCAGCAAATCCTGTTGGTGGCCACTACAACCGTGCGAAAACTG
TAAACGAGAACTTAAAGATGAGTGCTGCGCTTCTCTCGCGGTTTGATTTGGTTTTCATATTACTTGACAAACCTGATGAG
CTACTCGACAAGCAAGTCTCAGAGCATATTATGTCGCTTCATTCTGGAGGTGGAGAAGCACCACCTGCATTAAAGAAGTT
CAAGACAGCATCAGGATCTGCTAATGTGCATGCTAAAGAGGGTTCTCTACTCTCAAGACTGCGGTTAGACCCTAAGAAAG
ATGATGACTTCACTCCCATTCCTGGCCAACTGCTTAGGAAATATGTTGCTTATGCAAGGACTTTCGTCAACCCTAAGATG
TCAAAAGCAGCTGGAGAGATCATACAAAAGTTTTACTTGAAGTTGAGAGACCATAACACATCCGCTGACTCAACACCAAT
AACAGCAAGACAATTGGAAAGTTTGGTCAGGCTTGCGCAAGCTCGAGCTCGGGTTGACTTAAGGGAAGATATAACAGTCC
AGGACGCAATGGATGTGGTTGAAATAATGAAAGAATCTTTGTATGATAAGTTCGTAGATGAACATGGGGTTGTGGATTTT
GGTCGGAGTGGAGGAATGAGTCAACAAAAGGAGGCAAGACGCTTCTTAAGTGCTCTTGATAAGCAATCAGAGTTGCAGCA
GAAAGATTGTTACTCTGTTTCGGAGATGTATAGTTTAGCTGATAGGATCGGGTTACGAGTTCCAGACATCGATACATTCC
TAGAGAACCTGAACACTGCCGGCTACTTGCTCAAGAAGGGACCAAAAACTTACCAGGTCCTCTCCTCATCTTATTCTCGG
AGTCAATCATCCAGGTCAAGATGA