Details for Kale Locus Bo5g138130

Position : C5 ( 5`- 43205654 .. 43206820 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138130

Protein [Map View]
MADEFSGKIESKGLNPGLFVLLVIGGLLVTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKLKQGVQVPGE*

DNA
ATGGCCGATGAATTCTCTGGAAAAATCGAGAGCAAAGGGCTGAACCCAGGACTGTTCGTCCTTCTCGTGATTGGAGGGTT
GCTAGTGACGTTCCTTGTAGGAAACTTCATCCTCTACACATACGCTCAGAAGAATCTGCCTCCGAGGAAGAAGAAGCCGG
TTTCCAAGAAGAAGATGAAGAAAGAGAAGCTGAAGCAAGGCGTTCAAGTTCCTGGCGAGTAG