Details for Kale Locus Bo5g138120

Position : C5 ( 5`- 43203559 .. 43205207 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138120

Protein [Map View]
MTVIDILTRVDTICKKYDKYDVDKQRESNISGDDAFARLYGAFETQIETALEKAEIVTKEKNRASAVAMNAEIRRTKARL
AEEVPKLQRLAVKRVKGLTTEELAARNDLVLALPARIEAIPDGTAGGTKSTSSAWAPSATSRPDIKFDSDGRFDDDYFQE
SHESSQFRQEFEMRKIKQDQGLDMISEGLDALKNMASDMNEELDRQVPLMDEIDSKVDRATSDLKNTNVRLKDTVNQLRS
SRNFCIDIVLLCIVLGIAAYLYNVLK*

DNA
ATGACAGTGATCGACATTCTAACCAGAGTTGACACGATCTGTAAGAAGTACGACAAGTACGACGTCGACAAGCAGCGTGA
GTCCAACATCTCCGGCGACGATGCTTTCGCTCGCCTCTACGGAGCTTTCGAGACTCAAATCGAGACAGCTCTCGAGAAAG
CTGAGATTGTTACCAAGGAGAAGAACAGAGCTTCAGCTGTTGCGATGAACGCTGAGATCCGCAGGACCAAGGCTAGATTG
GCCGAGGAAGTTCCCAAGTTGCAGAGACTTGCTGTCAAGAGGGTTAAGGGCCTTACGACTGAAGAGCTTGCTGCGAGAAA
CGATTTGGTACTTGCGCTTCCGGCGAGGATTGAAGCTATACCTGATGGGACAGCGGGTGGTACTAAAAGCACTAGTAGTG
CTTGGGCTCCCTCTGCAACCTCTCGTCCTGATATCAAGTTTGATTCAGATGGGCGTTTTGATGATGACTACTTTCAAGAG
TCGCATGAATCCAGCCAGTTCCGACAGGAGTTTGAGATGCGGAAAATTAAACAGGACCAAGGTCTGGACATGATCTCCGA
AGGGTTAGATGCTTTGAAGAACATGGCATCTGATATGAACGAGGAGCTGGACCGTCAAGTTCCTTTGATGGATGAAATCG
ACTCAAAGGTGGACAGAGCAACCTCGGATCTTAAGAACACCAATGTTAGACTCAAAGATACTGTGAACCAGCTGAGGTCA
AGCAGGAACTTCTGCATCGATATTGTGTTGCTGTGTATTGTTCTGGGTATCGCTGCATACTTGTACAATGTACTCAAGTA
A