Details for Kale Locus Bo5g138100

Position : C5 ( 5`- 43186151 .. 43188907 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138100

Protein [Map View]
MDDRVRPREEEHKSSSLHDHNSPPQRDGDYAEIAEEEQLWRRGIVSSRTPQDTGDDLLRRNASLTSSPIAKRVNFSPMPS
PRISQRGASLSPCSSSSRNRPNNSLKNLIPKLTFKNKNSNNSNMDIEKAADLSFGASPPSSGNGRGRSTWTLGNILTPRL
KKTESLPVTPIAHSNPGSTHGRYVVDQVASMKKGPPLHIHRSRSVPAFNKDGSLRQSGVFRVIPTPDMTPTRNINKLNDT
NVDGGEDVPEEEAVCRICLVELGEDSEAFKMECMCRGELALAHKECTIKWFTIKGNRTCDVCKQEVQNLPVTLLRMQDSH
FNLGATEATLFRQVKSKQIPHSMVWQDVPILVIVSMLAYFCFLQQLLLTKMKSGAIAISLPFSCVFGLLASMTSTTMVKK
QYVWIYGTIQFGLVVFFSHIFFSLVHMQPVLSILLATVVGFGLTMSGATGIVEFSKWRRRRRTAELPSSSQADPPPVQSI
SES*

DNA
ATGGATGATAGAGTTAGACCTCGTGAAGAAGAACATAAGAGCTCCTCTCTTCATGATCATAATTCTCCACCGCAAAGGGA
TGGAGATTATGCTGAGATTGCAGAGGAAGAGCAGCTATGGAGGCGAGGCATTGTCTCATCAAGAACACCACAAGATACTG
GAGATGATCTTTTGAGACGTAATGCATCCTTAACATCAAGCCCTATTGCCAAAAGAGTCAACTTTTCTCCAATGCCGAGC
CCTAGAATCAGCCAACGTGGGGCTTCCCTCAGTCCTTGTTCGTCCTCTTCAAGAAACAGACCTAACAATAGCCTGAAGAA
TCTGATCCCAAAGTTGACCTTCAAAAACAAGAACAGCAATAACAGTAACATGGATATCGAGAAAGCTGCGGATTTGTCCT
TTGGTGCGTCTCCTCCTTCTTCAGGAAACGGCAGGGGCAGGTCTACATGGACTCTCGGTAATATTTTAACTCCAAGGTTG
AAGAAAACTGAGTCCTTGCCTGTAACCCCTATAGCTCACTCGAATCCTGGGTCCACACATGGGAGATATGTGGTTGATCA
GGTTGCTTCCATGAAAAAAGGGCCTCCACTGCATATTCACCGATCACGCTCAGTTCCAGCATTCAACAAAGATGGAAGTC
TAAGGCAATCAGGTGTTTTCCGGGTTATTCCTACTCCCGACATGACGCCAACCAGAAATATTAATAAACTTAACGACACG
AATGTTGATGGAGGAGAAGATGTTCCTGAGGAAGAAGCCGTGTGCAGAATCTGTTTGGTAGAATTGGGAGAAGATTCAGA
AGCCTTCAAAATGGAATGTATGTGTAGAGGTGAATTAGCTCTAGCACACAAAGAATGTACAATCAAATGGTTCACCATTA
AAGGAAACAGAACATGTGACGTGTGCAAGCAAGAGGTTCAGAACCTCCCTGTCACCCTTCTCCGCATGCAGGATTCTCAT
TTTAATCTTGGAGCTACCGAGGCTACTCTCTTCAGGCAAGTCAAATCCAAACAAATACCACATTCGATGGTATGGCAGGA
TGTTCCAATTCTTGTCATTGTAAGCATGCTTGCGTACTTTTGTTTCCTCCAGCAGCTTCTGCTAACCAAAATGAAATCAG
GCGCCATTGCAATATCTTTACCGTTCTCTTGTGTTTTTGGTCTTCTTGCCTCGATGACGTCAACTACAATGGTGAAGAAG
CAATATGTATGGATTTACGGCACAATTCAGTTCGGCCTTGTAGTTTTTTTCTCTCACATTTTCTTCTCATTGGTTCACAT
GCAGCCGGTTTTGTCTATTCTCTTAGCCACAGTGGTTGGTTTCGGACTCACCATGAGCGGCGCAACGGGTATAGTCGAGT
TTTCAAAATGGAGGAGACGCCGGAGGACAGCTGAACTTCCAAGCAGTAGTCAGGCTGATCCACCACCAGTTCAGAGTATC
TCTGAATCATGA