Details for Kale Locus Bo5g138090

Position : C5 ( 5`- 43179119 .. 43180530 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138090

Protein [Map View]
MGNISSSGGDRRRRRRSNTLPTAAPPPPPPPPPATEPPPNRIVFAAATPYPNPNPNQHYHQYPGYYPPPPGTMLPSPYDH
HHHYPPPPPPPPPHPYHHPHPWTAGGRYPYAGAMVPQPQPCVEHQKAVTIRNDVNLKKESLKLEPDPDCPGRFLVSFTFD
ATVSGRITVIFFAKESEECVLTATKEDVLPPITMDFEVGLGQKFKQPSGTGIDFSLFEEAELFKAAEADVYPLAVKAEAA
GAPPSGGDGEEAESLGSKNAQITQAVYEKDKGEVKIRVVKQILWVNETRYELQEIYGIGNSVDGDDDSADDANDPGKECV
ICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNSGSGNNTEQGGTGEQE*

DNA
ATGGGAAACATCAGCAGCAGCGGCGGCGATAGACGCCGGAGGCGTCGAAGCAACACGCTTCCAACCGCCGCTCCACCACC
ACCACCACCACCACCTCCGGCTACAGAACCTCCACCCAATCGAATCGTCTTCGCCGCGGCTACACCGTACCCAAACCCAA
ACCCTAATCAGCATTACCACCAGTACCCCGGCTACTACCCTCCTCCGCCGGGAACCATGCTTCCGTCTCCGTACGATCAC
CACCACCACTATCCCCCTCCTCCTCCTCCTCCTCCTCCCCATCCGTACCACCACCCTCACCCTTGGACCGCCGGCGGGAG
ATACCCTTACGCTGGAGCCATGGTCCCTCAGCCTCAGCCTTGCGTCGAGCATCAGAAAGCCGTCACGATTCGTAACGACG
TTAATCTCAAAAAGGAGTCTTTGAAGCTTGAACCCGACCCGGATTGTCCGGGTCGGTTTCTCGTCTCCTTCACGTTTGAT
GCAACTGTCTCCGGCAGGATTACAGTTATTTTTTTCGCTAAAGAATCCGAAGAATGCGTTCTCACAGCGACTAAGGAAGA
CGTTCTACCACCAATCACGATGGATTTCGAGGTAGGACTTGGTCAGAAGTTCAAACAGCCTTCTGGTACGGGGATAGACT
TCTCTCTCTTTGAAGAAGCTGAGCTGTTCAAGGCTGCGGAAGCTGATGTTTATCCCTTGGCTGTGAAGGCAGAAGCGGCA
GGGGCTCCTCCTTCGGGTGGTGATGGTGAAGAAGCGGAGAGTCTGGGGTCGAAGAATGCGCAGATCACTCAAGCGGTGTA
TGAGAAGGATAAAGGAGAGGTTAAGATAAGAGTGGTGAAGCAGATACTATGGGTTAACGAGACGAGGTATGAGCTGCAGG
AGATTTATGGGATTGGGAATAGCGTTGATGGGGATGATGATTCGGCTGATGATGCTAATGATCCGGGGAAGGAATGTGTT
ATTTGTTTGTCTGAGCCACGTGACACTACTGTTCTTCCCTGTCGGCACATGTGTATGTGCAGCGGATGCGCTAAGGTGTT
GAGGTTCCAGACAAATAGGTGCCCGATTTGTAGGCAGCCTGTAGAAAGGCTTTTGGAGATAAAAGTTCACGGTAATAGCG
GAAGCGGGAATAATACTGAACAAGGAGGAACAGGTGAACAAGAGTAG