Details for Kale Locus Bo5g138080

Position : C5 ( 5`- 43160065 .. 43162359 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138080

Protein [Map View]
METHLFLLVLSLLLFLSKPGSGFGSPGPIAASLGGNSAFFCAIDASGRQEVICWGKNYSSPSSPSSSSSSTSQTYNIPSM
AVLSGGDGFLCGVLSNTSQPFCFSSLGSSSSSGTDLVPLSYRTTAYSQIAAGNRHVCAVRGAYYSDHDSGTVDCWEITKA
ANNSFVAKESSNFYDQNVSNLVFNKIVSGDGFSCGVVREGGVLCFGPKSSTLGLNITTSDSFEVLSAGKSSVCAILNSTR
EIKCWGDEDSFVNSPGDKSRFVALASGPNHYCGIREDTHEVECWGDANFSLIPKASGFKAIASSDSIVCGIREEDLVLDC
WMVNGSSTLAYDPPLELCSPGVCRAGPCGDKEFAFNASILDEPDLTSLCVRKELSLCSPCGSDCSNGFFLSSSCTENSDR
VCTSCSLCQNSSCSDICKLHNHDSSSDKHWNQLALIVGSSASALLIIIICCCVVPRFVTSPNKEDGFKSCIGKTDLETEP
LEMIPPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLSDGRQVAVKRANASTIIHTNAREFEAELEILC
NIRHSNIVNLIGYSTEMGERLLVYEYMPHGTLHDHLHGGFSPLSWGLRVRIALQTAKGLEYLHVEAEPRIVHGDVKSSNV
LLDSEWAARVADFGLLTSSNERSLDVKGDVYDFGVVLLEILTGRKRYDRDCDPPEIVEWAVPVIREGKAAVVLDKYIASP
RNVEPLLKLADVAELCVREDPSQRPNTSELVNLLDQLARDGLLL*

DNA
ATGGAAACCCATCTCTTCCTCCTCGTTCTCTCACTCCTCCTATTCTTATCCAAACCCGGATCCGGATTCGGATCCCCCGG
CCCCATCGCGGCCTCCTTAGGCGGCAACTCTGCTTTCTTCTGCGCCATCGACGCTAGCGGACGCCAAGAAGTTATCTGCT
GGGGCAAAAACTACTCATCTCCTTCTTCTCCATCTTCCTCTTCTTCTTCAACTTCACAAACCTACAACATTCCTTCCATG
GCCGTTCTCTCAGGCGGAGACGGTTTCCTCTGCGGTGTTCTGTCCAACACATCTCAACCCTTTTGTTTCAGTTCACTTGG
ATCTTCTTCCTCCTCGGGTACGGATCTTGTCCCTCTCTCTTACAGGACAACTGCTTACTCTCAGATCGCTGCTGGAAACA
GACACGTCTGTGCAGTCAGAGGAGCTTACTATTCCGACCACGACTCTGGAACCGTAGACTGTTGGGAGATAACGAAAGCT
GCCAATAACAGTTTTGTCGCTAAAGAGAGTTCTAACTTCTACGATCAGAACGTTAGTAACCTCGTCTTCAACAAGATTGT
GTCTGGTGATGGGTTTAGCTGTGGTGTTGTCAGAGAAGGTGGGGTCCTCTGTTTCGGCCCAAAGTCTTCTACTTTAGGGC
TTAACATAACAACTTCAGACAGCTTCGAGGTGTTATCCGCTGGGAAAAGTTCAGTATGTGCGATTCTAAACTCAACTCGT
GAGATTAAATGTTGGGGAGACGAGGACTCTTTTGTTAATTCACCAGGTGATAAGTCTCGCTTCGTTGCGTTAGCATCTGG
TCCTAACCATTACTGCGGGATCCGCGAAGATACTCACGAGGTTGAGTGTTGGGGCGACGCTAACTTCTCGTTGATACCTA
AAGCTTCCGGCTTTAAGGCTATTGCGTCTTCTGACTCCATCGTTTGCGGTATAAGAGAAGAGGATCTCGTTCTCGACTGC
TGGATGGTTAACGGGTCGTCAACACTAGCGTACGATCCTCCTTTAGAGCTTTGCAGTCCAGGGGTATGTAGAGCTGGTCC
TTGTGGGGATAAAGAGTTTGCTTTCAACGCAAGCATCCTCGACGAGCCTGACCTAACGAGTTTATGCGTGAGGAAAGAGT
TGTCGCTCTGTTCTCCTTGCGGATCGGATTGCTCTAACGGATTCTTCTTGTCGAGTTCGTGCACCGAGAACTCTGACCGG
GTATGTACCTCGTGCTCGCTATGTCAGAACAGTTCTTGTTCCGACATTTGTAAGCTTCACAACCACGATTCTTCTTCAGA
CAAACATTGGAATCAGCTAGCTCTCATCGTCGGCTCTTCCGCCTCGGCTCTGTTGATCATCATCATCTGTTGTTGCGTCG
TGCCACGGTTTGTCACTAGTCCTAACAAAGAAGACGGTTTCAAATCTTGCATAGGAAAGACCGATCTAGAAACCGAGCCA
CTCGAAATGATCCCCCCTGCTCCATCGGTAACCCCTTTCGCGCAAGTGTTTAGGCTCTCCGAGCTTAAAGACGCGACCAA
CGGGTTCAAAGAGTTCAACGAGCTAGGCAGAGGAAGCTACGGGTTCGTCTACAAAGCCGTGTTATCCGATGGGAGACAAG
TCGCGGTTAAAAGAGCTAACGCATCGACGATAATCCACACTAACGCTAGAGAGTTCGAAGCCGAGCTGGAGATTCTATGC
AACATTAGGCATAGCAACATCGTGAATCTCATCGGCTACTCCACCGAGATGGGAGAGAGGCTTCTTGTCTACGAGTACAT
GCCTCACGGTACGCTTCACGACCATCTCCACGGCGGGTTTTCGCCGTTGAGTTGGGGGTTAAGGGTTCGCATCGCGTTGC
AAACGGCGAAGGGTCTCGAATATCTTCACGTTGAAGCTGAGCCGAGGATTGTGCATGGAGATGTGAAGTCTTCGAACGTG
CTTTTGGACTCCGAGTGGGCCGCGAGAGTTGCGGATTTTGGGCTTCTGACGTCGTCTAACGAGAGGAGTTTGGACGTCAA
AGGAGATGTTTATGACTTTGGGGTTGTGTTGTTGGAGATTTTGACCGGGAGGAAGCGTTACGATAGGGATTGTGACCCTC
CGGAGATAGTTGAATGGGCAGTTCCCGTGATCAGGGAAGGCAAAGCGGCGGTGGTTTTGGATAAGTATATTGCTTCGCCG
AGAAATGTGGAGCCGTTGTTGAAACTCGCTGACGTGGCGGAGTTGTGTGTACGGGAGGATCCGAGTCAACGACCAAACAC
GTCGGAACTTGTGAACTTGTTGGATCAGTTGGCCAGAGATGGACTGCTCCTGTAG