Details for Kale Locus Bo5g138070

Position : C5 ( 5`- 43157855 .. 43159158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138070

Protein [Map View]
MSGTHDSCPLVKNILLLDSEGKRVAVKYYSDDWATNAAKLSFEKYVFSKTSKTNARTEAEITLLDSNIIVYKFAQDLHFF
VTGGDDENELVLSSVLQGFFDAVALLLRNNVEKMEALENLDLIFLCLDEMVDQGVVLETDPNVIAGKVAMQSTEASGSLS
EQTLTQALATAREHLARSLLT*

DNA
ATGTCAGGGACTCATGATTCATGTCCTTTGGTAAAGAACATTCTTCTTCTGGACTCTGAAGGGAAGCGTGTGGCTGTCAA
GTATTACTCCGATGACTGGGCGACTAATGCTGCCAAGTTGAGTTTTGAGAAGTACGTATTCTCCAAGACCTCTAAGACCA
ATGCTCGCACAGAAGCTGAGATCACTTTGCTGGACAGTAATATTATTGTCTATAAGTTCGCCCAGGACCTTCACTTCTTT
GTCACTGGAGGCGATGATGAAAACGAGCTCGTCTTGTCTTCGGTTCTTCAAGGCTTTTTCGATGCTGTTGCACTTCTTCT
AAGGAACAATGTGGAAAAGATGGAAGCCCTTGAGAACTTGGATCTCATTTTTCTCTGCCTCGATGAAATGGTCGATCAGG
GGGTGGTTCTTGAAACAGACCCAAACGTCATTGCGGGAAAAGTAGCAATGCAGAGCACAGAAGCTAGTGGTTCACTCTCT
GAACAGACACTAACTCAAGCACTGGCAACAGCTCGGGAACATCTGGCAAGAAGTCTGCTTACATGA