Details for Kale Locus Bo5g138060

Position : C5 ( 5`- 43154888 .. 43156871 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138060

Protein [Map View]
MAAFLARRLLGTPTSSSSALISASRAFSSSTTPIKATLFPGDGIGPEIAESVKQVFTAADVAIDWDEHYVSTEVDPRTNS
FLTRESLQSVLDNKVGLKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEH
QVVKGVVESIKIITRKASMRVAEYAFLYAKTHGRKKVSAIHKANIMRKTDGLFLQCCDEVAEKYPEIEYEKVVIDNCCMM
LVKNPTLFDVLVMPNLYGDIISDLCAGLVGGLGLTPSCNIGEDGIALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHL
KLNKQAEQIHSAIINTIAEGKYRTADLGGTSTTTEFTKAICDHL*

DNA
ATGGCAGCATTTCTCGCTAGACGGCTTCTCGGCACTCCAACGTCTTCCTCCTCAGCGCTCATTTCCGCTTCTCGAGCCTT
CTCCTCCTCCACCACTCCGATCAAAGCAACCCTCTTCCCCGGCGACGGGATCGGTCCCGAGATCGCCGAATCCGTCAAAC
AGGTGTTTACCGCCGCTGACGTGGCAATTGATTGGGACGAGCATTACGTTAGTACTGAAGTGGATCCGAGAACCAATAGT
TTCTTGACGCGGGAGAGTCTTCAGTCCGTGCTTGATAACAAGGTTGGCTTAAAAGGACCTATGGCTACTCCCATTGGGAA
GGGTCACCGTTCCTTGAACCTTACTCTTAGGAAAGAGCTGAATCTCTATGCTAATGTTAGGCCTTGTTACAGCCTCCCTG
GGTACAAGACCCGTTATGATGACGTTGATCTTATTACTATTCGTGAGAACACTGAAGGAGAGTACAGTGGGCTTGAGCAT
CAGGTGGTTAAGGGTGTGGTGGAGAGTATTAAGATTATTACACGTAAGGCGAGTATGAGAGTTGCGGAATATGCTTTTCT
CTATGCTAAGACTCACGGAAGGAAGAAAGTTTCTGCTATTCATAAAGCCAATATTATGCGGAAAACTGATGGTCTTTTCC
TTCAGTGCTGTGATGAGGTAGCTGAGAAGTATCCTGAGATAGAATACGAGAAGGTTGTTATTGACAACTGCTGTATGATG
CTTGTGAAAAATCCAACACTTTTTGATGTCTTGGTGATGCCAAATCTCTATGGAGATATTATAAGCGATTTGTGTGCTGG
ACTAGTTGGGGGACTAGGACTGACTCCAAGTTGTAATATCGGGGAGGATGGTATTGCCCTTGCTGAAGCTGTGCACGGGT
CTGCACCAGATATTGCTGGAAAGAACTTGGCGAACCCGACAGCTTTGCTTCTGAGTGGAGTGATGATGTTGCGGCATCTC
AAGCTCAACAAACAAGCAGAGCAAATTCATAGCGCCATCATCAACACAATAGCGGAGGGGAAGTATAGAACCGCTGATCT
CGGAGGTACCTCAACCACAACAGAGTTCACAAAAGCCATCTGTGATCATCTCTAA