Details for Kale Locus Bo5g138010

Position : C5 ( 5`- 43122646 .. 43126628 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g138010

Protein [Map View]
MKCFFFSGGDKKDEHKTPNVSLTSNFSDRDINRSGSEFNSRDVSGTSTESSMGRRNSYPPTMSTRASNLREFSITDLKAA
TKNFSRSVMIGEGGFGCVYRGTVRSLEDPSIKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHTNLVKLLGYCAEDDERG
IQRLLVYEYMPNRSVEFHLSPRSLTILTWDLRLRIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDENWKAKLSDFGLA
RLGPSEGLTHVSTDVVGTMGYAAPEYIQTGRLTYKSDVWGYGVFVYELITGRKPVDRNKPKGEQKLLEWVRPYLSDTRKF
NLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVNKIVEAPSCSGTSPQLVPLKSLETSRDAGGKKKRG
LENGGGEGGWFGKLWNPKTIRAC*

DNA
ATGAAGTGTTTCTTCTTCTCTGGAGGGGACAAGAAAGACGAACACAAGACCCCTAATGTCTCACTGACCTCCAACTTCTC
TGACCGCGACATTAACCGAAGCGGGTCAGAGTTCAACTCTCGAGACGTCTCTGGCACGAGCACGGAGTCTTCCATGGGGA
GGAGGAACTCGTACCCTCCTACAATGTCTACTAGAGCTAGTAATCTGAGAGAGTTCAGCATCACTGATCTCAAGGCTGCA
ACAAAGAACTTCAGCAGGTCTGTTATGATTGGAGAAGGCGGTTTCGGTTGTGTCTACAGGGGAACAGTTAGGAGTTTAGA
AGATCCGTCTATCAAAATCGAAGTTGCTGTTAAGCAGCTTGGTAAAAGAGGGTTACAGGGGCATAAAGAATGGGTTACTG
AGGTTAACTTTCTTGGTGTGGTTGAGCATACAAACTTGGTGAAGTTGCTTGGCTATTGTGCAGAAGATGATGAGCGTGGG
ATCCAACGGCTTTTGGTTTATGAATACATGCCAAACCGAAGCGTTGAGTTCCACTTATCTCCTCGGTCACTCACCATCCT
TACTTGGGATCTCAGGTTGAGAATAGCTCAAGATGCAGCTCGTGGTTTAACATACCTTCACGAACAAATGGAGTTTCAGA
TAATATTCAGAGATTTTAAGTCATCGAACATTCTTTTGGATGAGAACTGGAAAGCAAAGCTCTCTGACTTTGGTTTGGCT
CGTTTAGGTCCATCTGAAGGACTAACTCATGTTTCTACTGATGTTGTAGGTACAATGGGTTATGCAGCTCCTGAGTATAT
TCAAACAGGTCGTCTCACATACAAAAGCGATGTGTGGGGTTATGGAGTGTTCGTCTACGAGCTCATCACAGGGAGGAAAC
CAGTTGATAGGAACAAACCTAAGGGAGAGCAGAAGCTTCTAGAATGGGTGAGACCTTATCTATCCGACACAAGGAAGTTC
AACCTCATATTAGACCCGAGGCTAGAAGGGAAGTACCCTCTCAAATCAGTTCAGAAGCTAGCGGTTGTGGCCAACAGGTG
TTTAGTTAGAAACCCAAAGGCACGTCCCAAGATGAGTGAAGTGTTGGAGATGGTGAACAAGATTGTGGAAGCGCCTTCAT
GTAGCGGTACTAGCCCGCAGCTAGTTCCGTTGAAGAGTTTGGAGACTTCTAGAGACGCTGGAGGGAAAAAGAAGAGGGGT
TTAGAGAACGGTGGTGGTGAAGGAGGTTGGTTTGGTAAGTTATGGAACCCAAAGACAATAAGAGCTTGTTGA