Details for Kale Locus Bo5g137990

Position : C5 ( 5`- 43115922 .. 43118138 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137990

Protein [Map View]
MRGGGKRRSSGGGSGRSKSRSPGHRAAGSSSGGRRRRTNNTLFVEGGALADFPKDHSFSTPSRGRSSSGKGSKKPGSSDR
AKASASGLRRCSGQTYAYQYPSRDQTVGVGSNQLLLGKTDGNPIVAYLDDQTPSKEVVKVNYEYGYEPSFVLGGDDDDSH
KGLGFESDAGPSGSLSVSKALGDEETCEEGGDEAMPDVVKVKPSKRNSGFISIGGMKLYTEDISDDEESGGEEEEGSIGS
VESEESSDESESSEYMFGSDTEIDDAVAKDYLEGIGGSENMLDAHWLAEKSLDQLDLSDTSGSDSSAEMKTGKKLTGFAL
QKASMEYGKKKFTRSGSSGHGKATMDDLMFVKDPRSLSGKKNKKTKFLPQSWPSGAQKSKHSRNFPGEKKKHRKEYIALK
RRERMLQRGVDLADINIQLGRFVLENVDMHCFQRMHNRDCSQVRRLADVYRLSSSCTGSGKKSFVTVTRTYQTCMPSASD
KVRIEKLIGAGEEEEDFAVSGGGVKVKSGGLERKKAKDSAKKRPTREERERNKSSGKKSSYAEQPVSFVSSGIIDSEIAV
AKTSFDVKDAKQVGEATPEASSGADIGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDFSI
DTEEASPSSNNNAKRNRSSSSGKQVKRVSHVIGGGSGSARIRDKRLGAFEQHTTGFGSRMMARMGFVDGSGLGRESQGIV
NPLVAVRRPKARGLGAEG*

DNA
ATGCGAGGCGGTGGCAAGAGAAGATCAAGCGGCGGTGGTTCCGGGAGAAGCAAATCCAGATCTCCCGGACACCGCGCGGC
GGGTTCTTCCTCCGGCGGTCGTCGGCGACGTACCAACAACACTCTGTTCGTAGAAGGAGGCGCTCTCGCCGATTTCCCGA
AAGATCATTCCTTTTCGACGCCGTCTCGTGGAAGAAGCTCTTCCGGAAAGGGATCGAAGAAGCCCGGAAGCTCAGATCGT
GCAAAAGCTTCTGCTTCTGGTCTGAGGAGATGCAGTGGTCAAACCTACGCCTATCAGTATCCTTCACGCGATCAAACGGT
TGGAGTTGGATCGAATCAGTTACTTCTGGGGAAGACAGATGGGAACCCGATCGTTGCGTATCTTGATGATCAGACGCCTT
CGAAGGAAGTGGTTAAGGTAAATTATGAGTATGGATACGAGCCGAGTTTTGTTTTGGGTGGTGATGATGACGACTCTCAT
AAAGGATTGGGCTTTGAATCTGATGCTGGGCCAAGTGGTAGCCTTTCTGTTTCTAAGGCATTGGGAGATGAAGAGACTTG
TGAAGAGGGTGGAGATGAGGCGATGCCTGATGTTGTGAAAGTGAAACCGTCGAAGAGGAACTCAGGGTTCATTTCTATTG
GAGGGATGAAGCTTTACACTGAAGATATATCTGATGATGAAGAGAGTGGTGGAGAAGAAGAGGAAGGAAGCATTGGGTCT
GTAGAGAGTGAGGAGTCATCTGATGAGAGTGAAAGCTCGGAGTATATGTTTGGAAGTGATACCGAGATTGATGACGCCGT
TGCGAAGGATTACTTGGAAGGTATTGGTGGCAGTGAGAATATGTTGGATGCTCATTGGCTGGCAGAAAAGTCACTAGATC
AACTGGATTTGTCTGACACTTCTGGAAGTGATTCTTCTGCTGAGATGAAGACAGGGAAGAAGCTGACTGGTTTTGCTCTA
CAAAAGGCGTCAATGGAGTATGGCAAGAAGAAGTTTACAAGAAGTGGTTCATCAGGGCATGGTAAGGCTACAATGGATGA
TCTTATGTTTGTGAAAGATCCAAGAAGTCTTTCGGGGAAGAAGAATAAGAAGACTAAGTTTCTTCCACAGTCTTGGCCTT
CAGGGGCACAAAAGAGCAAGCATTCTCGTAACTTTCCTGGTGAGAAGAAGAAACATCGCAAAGAGTATATTGCTCTGAAG
CGTCGCGAGAGAATGTTGCAGCGCGGTGTTGATCTTGCTGATATAAACATTCAGTTAGGGCGTTTCGTTCTTGAAAACGT
GGACATGCACTGTTTCCAGCGTATGCATAACCGAGATTGCTCTCAGGTAAGACGGTTAGCAGATGTGTACCGCTTATCAA
GTAGCTGCACTGGTTCTGGAAAGAAAAGCTTTGTGACGGTTACTAGAACGTATCAGACATGTATGCCTTCTGCTAGCGAT
AAGGTTCGAATTGAGAAGCTAATAGGAGCAGGAGAGGAGGAGGAGGATTTTGCTGTCAGCGGAGGAGGGGTGAAGGTTAA
ATCTGGAGGTTTAGAGAGGAAGAAAGCGAAAGACTCAGCCAAAAAGCGGCCTACTAGAGAAGAACGGGAGAGAAACAAAA
GCAGCGGGAAGAAGAGTTCATATGCTGAGCAACCTGTTTCGTTTGTGTCAAGTGGTATTATTGATTCTGAGATCGCTGTG
GCAAAGACGTCTTTTGATGTCAAAGATGCTAAACAAGTGGGTGAAGCTACTCCGGAAGCCTCTAGTGGAGCAGATATTGG
AGCGTTTGAGGTACACACCAGAGGCTTTGGATCTAAAATGATGGCAAAAATGGGATTCATAGAAGGAGGCGGTCTAGGAA
AGGAGGGTAAGGGGATAGCACAGCCAATAGAAGCTGTTCAACGTCCGAAATCACTTGGTTTAGGTCTGGATTTCTCCATT
GATACCGAAGAGGCTAGTCCATCAAGCAATAACAACGCTAAAAGGAACAGATCTTCTTCCTCTGGGAAACAAGTCAAACG
CGTCTCCCATGTCATTGGTGGTGGCTCTGGCTCAGCAAGGATTAGAGACAAAAGATTGGGAGCCTTTGAGCAGCACACAA
CAGGTTTTGGTTCGAGGATGATGGCGAGAATGGGTTTTGTGGATGGCTCTGGTTTGGGAAGAGAGTCACAAGGCATAGTC
AATCCGTTGGTCGCTGTGAGACGTCCTAAAGCACGTGGACTAGGCGCTGAAGGCTAA