Details for Kale Locus Bo5g137950

Position : C5 ( 5`- 43104507 .. 43105955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137950

Protein [Map View]
MKLNEIKKKERSDYLPKGRLSKRVEDCGEFEEEGNGATTVPSDVKEGHVAVIAVKGERVVRFVFELQELYKPEFRKLLEH
AGEEFGFQPRGPLTILCQPEEEEHKLFLIRVLIPLHKPKPIEIYHQQLSYCIVQFVEKDYKLADTVIRGLLKYLPVTNCT
KENLFLQELEEVLEATQPVEFQRCMVPLFQQIARCLNSSHFQHIEAMKIEILFANVFCAYHLQVNFVFEKKARIFIVTIT
ERWIIRTL*

DNA
ATGAAATTGAACGAAATCAAAAAGAAGGAGAGGTCGGATTATCTTCCAAAAGGCCGATTATCCAAGAGGGTTGAAGATTG
TGGTGAGTTTGAGGAAGAGGGTAATGGTGCAACAACGGTTCCCAGTGATGTTAAAGAAGGGCATGTGGCAGTGATTGCTG
TAAAAGGAGAGAGAGTTGTGAGGTTTGTTTTTGAGCTTCAAGAATTGTACAAACCTGAGTTCAGGAAACTGCTTGAACAT
GCGGGAGAGGAGTTTGGGTTTCAACCTAGAGGACCTCTCACCATTCTCTGTCAGCCAGAAGAAGAGGAGCACAAGCTGTT
TCTCATCAGGGTGTTGATACCGTTGCATAAGCCTAAACCGATAGAGATATATCATCAGCAGTTGTCTTATTGCATCGTTC
AGTTTGTGGAAAAGGATTATAAGCTAGCGGATACAGTCATCAGGGGGTTGTTGAAGTATTTGCCTGTGACGAATTGCACC
AAGGAGAATCTCTTCCTTCAGGAACTTGAAGAAGTTCTTGAGGCAACGCAGCCTGTTGAGTTCCAGCGTTGCATGGTTCC
ATTGTTTCAACAGATTGCTCGCTGCCTCAATAGCTCTCACTTTCAGCATATTGAGGCAATGAAAATTGAGATATTGTTTG
CTAATGTCTTCTGTGCGTATCACCTTCAAGTCAATTTTGTTTTTGAGAAAAAAGCAAGGATATTCATTGTGACGATAACG
GAGAGATGGATTATCAGAACACTATAA